StarFunc result for job id Q6ZQQ6

User Input

>input (1400 residues)
MSSPRLIPLWKDLKLLLNDTINKSKQPSEDPKNCLIVLSDRSQAVAWMKSKTEDMVEKRT
FSMTERLPPIQSMVHAGSFHILVVYCGDLILRLFGDHFRAFKPLGKVPCRFNISCLCYDP
EMKMLLSGILGAVVTWVIELGGTGLQIAHMVSMPGDELVQDIVLNGPSGSLLALCETVVR
VLMHQGKGQLGEVKRFTSTSSGSSITCCFTCFDQGFLYAGNQAGEIQVWSLQQGHPLHSF
QAHQSGVICIRSRPEAHTLLTAGSDSLIKEWNLTSGSLLRRLELGEELYRLQFIDSITFF
CQTAHSFSLHRLPCFYSLFNVCGSAPQQLRRVCCGNNWFRILCTTEDGLLRFVSPVTGDL
LVITWPFSILDQAVDWAYDPGKEELFVATGSSEVLVFDTTRCPCPAKYLLGTSPNSQDFV
QCLAYGHFNLGRGLEGLIFSGHQSGVIRVLSQHSCARLEKFMHFGAVLALSTLSGGIFGG
QGNSLLCSYGMDDYVHLSEAVLDGVKVQLRPLASILSSCHLTHLILLPKSVGAITETNCL
RLWKFHDFLSSGSQNGLKFIETLPLHLCAITSFDVCLSLSLFVTGSADGSVRIWDFHGRL
IGILDSSLHFGPVCFANDRGDLLVTFNQSLYLVSCLKLLPPALLTRLSFMSISDEVLEVP
KPFIPSFFFSFETMFVPKYIYPGQAQQKLVGLEKLVNNRAIAFDHSVPHVIEEDEEGSPV
LLRSSMHYSLQDMEDWMQVSKRYQCHYVLPPQLQLTSWDGLNPYQILRYYFGHGREWLFA
PDCYIPNSVIRARLWPEGTPIYLQCNLHAPQRELEWDRSQEFFFWHSRVRAISNTEYPKN
KEEDEHFLEMRLSKDVTYSVLTDGANRSWLGRKMSEITINSMIETMLNIMVHASLLKYQC
CVGALGQIFASYQVSPALRSETARRLLNDTTNSNPLIRELAWEGLKRLGMITHLFAMPLA
QGLMDKDERVRIKTLSLMAEIGIHSRTSLLQLTQKQETFREMQQQMIGEEPLDHLLGMRA
TDLQILSTQVEQRLNENLTLSHRDEKPAFSLDVSMPSELKSSLKPPTVSEESEVAIKPSK
GQRRGQAGVKKHSQKWLRGLKKTKERDSKQMSTEPGLLEDESGTEAAPIEMEEASVYSQW
SSSTSVIKLSKDVDSQEKDISKDHIALTLKRLQKIRDKRDKKATAQKLKKKHKKKGKEAK
VINEETTPPVMEQPVTKKVKIQGRGASGISGRRSTAGDGSSWRDDLCRLMALRISGSQTK
MSENLNAELVTFAQEMLVDRHPSWELFQEICPLLKKESKVLLEDLDWDVVPPEKKPIFIQ
EGAIREDMIQGVTQEVIRHKEVMPREEEQAQKKARDMLGLEETQVILKKGKKVIFLEPGN
VTMGKEISKKEEKKTFQKSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7mq8LT	0.203	0.297	1.496E-22	869	0.088	0.142	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
2	AFDB:O60336	0.195	0.185	3.542E-22	1514	0.134	0.124	O60336.pdb.gz	MABP1_HUMAN Mitogen-activated protein kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=MAPKBP1 PE=1 SV=4
3	AFDB:M9PB01	0.180	0.116	1.130E-21	2397	0.118	0.069	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
4	PDB:7mq8LR	0.168	0.289	4.853E-21	773	0.065	0.118	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	PDB:7mq8LO	0.182	0.265	3.465E-19	848	0.081	0.133	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	PDB:7mqaLQ	0.156	0.254	4.172E-19	830	0.056	0.094	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
7	PDB:7d5sBE	0.188	0.278	8.366E-19	865	0.091	0.147	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
8	PDB:7d4iBE	0.201	0.290	1.678E-18	890	0.089	0.139	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
9	PDB:7ajuUL	0.149	0.254	6.443E-18	779	0.063	0.113	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
10	PDB:7ajtUA	0.169	0.275	1.025E-17	834	0.053	0.089	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
11	PDB:6lqsB1	0.171	0.286	2.843E-17	806	0.059	0.102	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
12	PDB:5m2nA	0.172	0.320	3.586E-17	711	0.063	0.124	5m2nA.pdb.gz
13	AFDB:O13046	0.133	0.163	6.461E-14	1127	0.099	0.123	O13046.pdb.gz	WDHD1_XENLA WD repeat and HMG-box DNA-binding protein 1 OS=Xenopus laevis OX=8355 GN=wdhd1 PE=1 SV=1
14	AFDB:O96221	0.088	0.084	3.658E-12	1471	0.094	0.089	O96221.pdb.gz	O96221_PLAF7 Protein transport protein SEC31 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0214100 PE=3 SV=3
15	AFDB:Q9W1X4	0.119	0.099	7.038E-9	1711	0.114	0.093	Q9W1X4.pdb.gz	NU214_DROME Nuclear pore complex protein Nup214 OS=Drosophila melanogaster OX=7227 GN=Nup214 PE=1 SV=2
16	AFDB:Q80U93	0.124	0.086	1.549E-8	2085	0.126	0.084	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2
17	AFDB:P35658	0.102	0.073	5.264E-7	2090	0.128	0.086	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
18	AFDB:Q9NSI6	0.121	0.081	3.870E-6	2320	0.130	0.078	Q9NSI6.pdb.gz	BRWD1_HUMAN Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=BRWD1 PE=1 SV=4
19	AFDB:F4I1T7	0.108	0.086	2.363E-5	1819	0.135	0.104	F4I1T7.pdb.gz	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1
20	AFDB:Q8CJF7	0.096	0.065	2.980E-5	2243	0.116	0.073	Q8CJF7.pdb.gz	ELYS_MOUSE Protein ELYS OS=Mus musculus OX=10090 GN=Ahctf1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16371	2.98e-07	57.4	730	0.050	0.096	GROU_DROME Protein groucho OS=Drosophila melanogaster OX=7227 GN=gro PE=1 SV=3
2	F4HTH8	3.55e-06	54.3	1181	0.021	0.025	KTN82_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 OS=Arabidopsis thaliana OX=3702 GN=KTN80.2 PE=1 SV=1
3	F4KB17	2.48e-05	51.2	839	0.016	0.027	KTN83_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3 OS=Arabidopsis thaliana OX=3702 GN=KTN80.3 PE=1 SV=1
4	Q8H0T9	2.67e-05	51.2	837	0.017	0.029	KTN84_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4 OS=Arabidopsis thaliana OX=3702 GN=KTN80.4 PE=1 SV=3
5	Q91WQ5	3.53e-05	50.8	589	0.016	0.037	TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus OX=10090 GN=Taf5l PE=2 SV=1
6	O13166	3.76e-05	50.8	761	0.048	0.088	TLE3A_DANRE Transducin-like enhancer protein 3-A OS=Danio rerio OX=7955 GN=tle3a PE=1 SV=1
7	A0A1P8AW69	4.13e-05	50.8	1019	0.024	0.032	KTN81_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1 OS=Arabidopsis thaliana OX=3702 GN=KTN80.1 PE=1 SV=1
8	O75529	6.30e-05	49.7	589	0.016	0.037	TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens OX=9606 GN=TAF5L PE=1 SV=1
9	Q8MY12	6.82e-05	50.1	780	0.016	0.029	MHCKC_DICDI Myosin heavy chain kinase C OS=Dictyostelium discoideum OX=44689 GN=mhkC PE=1 SV=1
10	A0A2R8QFQ6	8.09e-05	49.3	562	0.027	0.068	FB11A_DANRE F-box and WD repeat domain-containing 11-A OS=Danio rerio OX=7955 GN=fbxw11a PE=2 SV=1
11	O13168	9.14e-05	49.3	771	0.041	0.074	TLE3B_DANRE Transducin-like enhancer protein 3-B OS=Danio rerio OX=7955 GN=tle3b PE=1 SV=2
12	Q5A756	1.33e-04	48.9	981	0.019	0.027	Q5A756_CANAL SnoRNA-binding rRNA-processing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DIP2 PE=4 SV=1
13	Q5B915	1.42e-04	48.5	592	0.021	0.049	Q5B915_EMENI Cell cycle regulatory protein (Srw1), putative (AFU_orthologue AFUA_3G08280) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02965 PE=4 SV=1
14	Q9VDE3	1.59e-04	48.5	510	0.017	0.047	Q9VDE3_DROME LD08669p OS=Drosophila melanogaster OX=7227 GN=slmb PE=1 SV=1
15	O44382	1.82e-04	48.1	510	0.017	0.047	O44382_DROME Slimb OS=Drosophila melanogaster OX=7227 GN=slmb PE=2 SV=1
16	Q2TAY7	2.01e-04	48.1	513	0.019	0.053	SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens OX=9606 GN=SMU1 PE=1 SV=2
17	Q76B40	2.01e-04	48.1	513	0.019	0.053	SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus OX=10029 GN=SMU1 PE=1 SV=1
18	A0A0B4KHK1	2.10e-04	48.1	597	0.017	0.040	A0A0B4KHK1_DROME Supernumerary limbs, isoform B OS=Drosophila melanogaster OX=7227 GN=slmb PE=4 SV=1
19	O13286	2.13e-04	48.1	556	0.027	0.068	SRW1_SCHPO WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srw1 PE=1 SV=1
20	Q5SRY7	2.20e-04	48.1	542	0.017	0.044	FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus OX=10090 GN=Fbxw11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	51	15.6	Anaphase-promoting complex subunit 4 WD40 domain
2	PF15036 IL34	3.2e+02	12.8	Interleukin 34
3	PF20426 NBCH_WD40	63	13.8	Neurobeachin beta propeller domain
4	PF00400 WD40	0.00017	33.5	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000405012

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385347	0.550	Transmembrane anterior posterior transformation protein 1 homolog
2	9606.ENSP00000416696	0.523	RAB6A-GEF complex partner protein 1
3	9606.ENSP00000297866	0.504	Cilia- and flagella-associated protein 47
4	9606.ENSP00000367926	0.504	Cilia- and flagella-associated protein 47
5	9606.ENSP00000367929	0.504	Cilia- and flagella-associated protein 47
6	9606.ENSP00000323555	0.503	Olfactory receptor 8K3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.954	developmental process
GO:0009987	0.942	cellular process
GO:0030154	0.748	cell differentiation
GO:0048468	0.631	cell development
GO:0032501	0.618	multicellular organismal process
GO:0071840	0.456	cellular component organization or biogenesis
GO:0016043	0.449	cellular component organization
GO:0050789	0.341	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0043227	0.996	membrane-bounded organelle
GO:0005737	0.961	cytoplasm
GO:0043229	0.787	intracellular organelle
GO:0043231	0.477	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]