StarFunc result for job id Q6ZR08

User Input

>input (1400 residues)
MSDANKAAIAAEKEALNLKLPPIVHLPENIGVDTPTQSKLLKYRRSKEQQQKINQLVIDG
AKRNLDRTLGKRTPLLPPPDYPQTMTSEMKKKGFNYIYMKQCVESSPLVPIQQEWLDHML
RLIPESLKEGKEREELLESLINEVSSDFENSMKRYLVQSVLVKPPVKSLEDEGGPLPESP
VGLDYSNPWHSSYVQARNQIFSNLHIIHPTMKMLLDLGYTTFADTVLLDFTGIRAKGPID
CESLKTDLSIQTRNAEEKIMNTWYPKVINLFTKKEALEGVKPEKLDAFYSCVSTLMSNQL
KDLLRRTVEGFVKLFDPKDQQRLPIFKIELTFDDDKMEFYPTFQDLEDNVLSLVERIAEA
LQNVQTIPSWLSGTSTPVNLDTELPEHVLHWAVDTLKAAVHRNLEGARKHYETYVEKYNW
LLDGTAVENIETFQTEDHTFDEYTEFIEKFLSLASEIMLLPQWIHYTMVRLDCEDLKTGL
TNKAKAFANILLNDIASKYRKENECICSEFEAIKEHALKVPETTEEMMDLISYVEKARTV
GIEELILRIQESKRQMSYFLDVFLFPQEDLALNATVLMWPRKINPIFDENDELIENAKHK
KENELMAKREKLILEIEKESRRMEEFTEFAELERMQQYVTDVRQLQKRIQESEEAVQFIN
KEEELFKWELTKYPELDKLKVNIEPYQKFFNFVLKWQRSEKRWMDGGFLDLNGESMEADV
EEFSREIFKTLKFFQTKLKKELQEKRKAARKRSLEEEKIEEEPKDNATITMCRMRARHWK
QISEIVGYDLTPDSGTTLRKVLKLNLTPYLEQFEVISAGASKEFSLEKAMNTMIGTWEDI
AFHISLYRDTGVCILSSVDEIQAILDDQIIKTQTMRGSPFIKPFEHEIKAWEDRLIRIQE
TIDEWLKVQAQWLYLEPIFCSEDIMQQMPEEGRQFQTVDRHWRDIMKFCAKDPKVLAATS
LTGLLEKLQNCNELLEKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPH
LKKCFEGIAKLEFLPNLDIKAMYSSEGERVELIALISTSAARGAVEKWLIQVEDLMLRSV
HDVIAAARLAYPESARRDWVREWPGQVVLCISQMFWTSETQEVISGGTEGLKKYYKELQN
QLNEIVELVRGKLSKQTRTTLGALVTIDVHARDVVMDMIKMGVSHDTDFLWLAQLRYYWE
NENARVRIINCNVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKT
ETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQ
QILCIQRAIQQKLVVFVFEGTELKLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMV
PNYALIAEISLYSYGFLNAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7z8fe	0.404	0.133	3.004E-50	4579	0.201	0.061	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
2	PDB:7z8gA	0.395	0.189	9.872E-42	3047	0.152	0.070	7z8gA.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
3	PDB:5nugA	0.313	0.155	2.831E-37	2920	0.150	0.072	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
4	PDB:7kzmC	0.410	0.152	3.227E-37	3890	0.237	0.085	7kzmC.pdb.gz	Structure of a microtubule-bound axonemal dynein.
5	AFDB:Q9TW74	0.272	0.654	1.414E-35	579	0.127	0.307	Q9TW74.pdb.gz	Q9TW74_DROME Dynein (Fragment) OS=Drosophila melanogaster OX=7227 GN=kl-5 PE=2 SV=1
6	PDB:7mi6A	0.379	0.224	5.547E-32	2419	0.119	0.069	7mi6A.pdb.gz	Targeting allostery in the Dynein motor domain with small molecule inhibitors.
7	PDB:4w8fB	0.369	0.204	1.272E-31	2609	0.119	0.064	4w8fB.pdb.gz	Allosteric communication in the Dynein motor domain.
8	PDB:7mi8A	0.267	0.425	3.257E-22	868	0.092	0.149	7mi8A.pdb.gz
9	AFDB:O08827	0.124	0.837	4.848E-20	204	0.091	0.627	O08827.pdb.gz	O08827_MOUSE Axonemal dynein heavy chain (Fragment) OS=Mus musculus OX=10090 GN=Dnah6 PE=2 SV=1
10	AFDB:Q9VN30	0.255	0.321	5.990E-17	1079	0.086	0.112	Q9VN30.pdb.gz	Q9VN30_DROME Dynein heavy chain linker domain-containing protein OS=Drosophila melanogaster OX=7227 GN=sac PE=4 SV=3
11	AFDB:E7FFM4	0.122	0.064	1.958E-12	2685	0.067	0.035	E7FFM4.pdb.gz
12	AFDB:V9GZM8	0.083	0.984	9.978E-11	116	0.067	0.810	V9GZM8.pdb.gz	V9GZM8_DROME Drosophila melanogaster dynein-related heavy chain polypeptide protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dhc62B PE=4 SV=1
13	AFDB:V9GZG7	0.082	0.980	4.037E-10	116	0.065	0.784	V9GZG7.pdb.gz	V9GZG7_DROME Drosophila melanogaster dynein-related heavy chain polypeptide protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dhc36C PE=4 SV=1
14	AFDB:Q56HA9	0.109	0.952	1.945E-9	157	0.051	0.459	Q56HA9.pdb.gz
15	AFDB:O08825	0.072	0.976	2.057E-8	101	0.042	0.584	O08825.pdb.gz	O08825_MOUSE Dynein heavy chain (Fragment) OS=Mus musculus OX=10090 GN=Dnah10 PE=2 SV=1
16	AFDB:Q281W6	0.093	0.962	2.792E-8	133	0.059	0.617	Q281W6.pdb.gz	Q281W6_DROME Kl-2 protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=kl-2 PE=4 SV=1
17	AFDB:A3KMH1	0.110	0.083	1.872E-5	1905	0.031	0.023	A3KMH1.pdb.gz	VWA8_HUMAN von Willebrand factor A domain-containing protein 8 OS=Homo sapiens OX=9606 GN=VWA8 PE=1 SV=2
18	PDB:5jcss	0.100	0.072	4.241E-4	2003	0.036	0.025	5jcss.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
19	PDB:7plo7	0.079	0.159	1.109E-3	607	0.023	0.053	7plo7.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
20	PDB:6skl3	0.086	0.178	1.158E-3	616	0.027	0.062	6skl3.pdb.gz	Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A6H2EJG3	0.0	948	4065	0.391	0.135	A0A6H2EJG3_DROME Dynein heavy chain at 36C, isoform C OS=Drosophila melanogaster OX=7227 GN=Dhc36C PE=3 SV=1
2	E9Q0B6	0.0	630	4144	0.287	0.097	E9Q0B6_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
3	E9Q8T7	0.0	785	4250	0.322	0.106	DYH1_MOUSE Dynein axonemal heavy chain 1 OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1
4	Q384K3	0.0	632	4152	0.289	0.098	Q384K3_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0390 PE=4 SV=1
5	Q38B68	0.0	626	4142	0.261	0.088	Q38B68_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1720 PE=4 SV=1
6	Q4AC22	0.0	847	4149	0.364	0.123	Q4AC22_CHLRE Dynein heavy chain 9 OS=Chlamydomonas reinhardtii OX=3055 GN=DHC9 PE=1 SV=3
7	Q585U4	0.0	680	4246	0.288	0.095	Q585U4_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.85 PE=4 SV=1
8	Q7KVA7	0.0	941	3964	0.386	0.136	Q7KVA7_DROME Dynein heavy chain at 62B OS=Drosophila melanogaster OX=7227 GN=Dhc62B PE=3 SV=2
9	Q8WXX0	0.0	1107	4024	0.421	0.146	DYH7_HUMAN Dynein axonemal heavy chain 7 OS=Homo sapiens OX=9606 GN=DNAH7 PE=1 SV=2
10	Q9P2D7	0.0	790	4265	0.322	0.106	DYH1_HUMAN Dynein axonemal heavy chain 1 OS=Homo sapiens OX=9606 GN=DNAH1 PE=1 SV=6
11	Q9VJC6	0.0	949	4024	0.391	0.136	Q9VJC6_DROME Dynein heavy chain at 36C, isoform B OS=Drosophila melanogaster OX=7227 GN=Dhc36C PE=3 SV=2
12	Q9VZ77	0.0	742	4385	0.312	0.100	Q9VZ77_DROME Dynein, axonemal, heavy chain 3, isoform D OS=Drosophila melanogaster OX=7227 GN=Dnah3 PE=3 SV=3
13	Q9P225	2.28e-170	569	4427	0.274	0.087	DYH2_HUMAN Dynein axonemal heavy chain 2 OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3
14	P0C6F1	2.54e-170	568	4456	0.225	0.071	DYH2_MOUSE Dynein axonemal heavy chain 2 OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1
15	Q9VWZ3	2.57e-169	566	4081	0.226	0.078	Q9VWZ3_DROME Dynein heavy chain at 16F OS=Drosophila melanogaster OX=7227 GN=Dhc16F PE=3 SV=1
16	E9Q3H7	1.61e-166	557	4092	0.268	0.092	E9Q3H7_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
17	Q9SMH3	1.17e-164	552	4625	0.264	0.080	DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1
18	D3YYQ8	3.55e-163	548	4591	0.274	0.083	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
19	F7ABZ6	5.69e-163	547	4534	0.274	0.084	F7ABZ6_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
20	Q9MBF8	6.93e-160	538	4513	0.261	0.081	DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	1e+02	14.7	ATPase family associated with various cellular activities (AAA)
2	PF13238 AAA_18	70	15.4	AAA domain
3	PF13521 AAA_28	6.4e+02	12.0	AAA domain
4	PF07728 AAA_5	30	16.0	AAA domain (dynein-related subfamily)
5	PF12774 AAA_6	3.3e-93	323.9	Hydrolytic ATP binding site of dynein motor region
6	PF08393 DHC_N2	1.6e-130	447.4	Dynein heavy chain, N-terminal region 2
7	PF00910 RNA_helicase	1.2e+02	14.5	RNA helicase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008970302.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008960960.1	0.948	Dynactin subunit 1 isoform X1
2	9597.XP_003824906.1	0.940	Dynactin subunit 2 isoform X1
3	9597.XP_003830818.1	0.911	Dynactin subunit 6
4	9597.XP_003829855.1	0.901	Dynactin subunit 3
5	9597.XP_003813753.1	0.881	Dynactin subunit 5
6	9597.XP_003806183.1	0.862	ARP1 actin-related protein 1 homolog B, centractin beta
7	9597.XP_003829058.1	0.862	Dynactin subunit 4 isoform X1
8	9597.XP_003825570.1	0.853	ARP1 actin-related protein 1 homolog A, centractin alpha
9	9597.XP_003831713.2	0.849	Belongs to the actin family.
10	9597.XP_003809329.1	0.703	Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the peripheral transport of microtubule fragments and the coupling of the nucleus and centrosome. Required during brain development for the proliferation of neuronal precursors and the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Neuro [...]
11	9597.XP_008950754.1	0.692	CAP-Gly domain-containing linker protein 4
12	9597.XP_003812558.1	0.667	Sperm associated antigen 16
13	9597.XP_008955981.1	0.651	CAP-Gly domain-containing linker protein 1
14	9597.XP_003820535.1	0.648	TBC1 domain family member 31 isoform X1
15	9597.XP_008950165.1	0.645	Belongs to the FGGY kinase family.
16	9597.XP_008966790.1	0.640	CAP-Gly domain-containing linker protein 2
17	9597.XP_003829847.1	0.629	Dynein axonemal intermediate chain 1
18	9597.XP_008959544.1	0.602	Cytoplasmic dynein 2 light intermediate chain 1 isoform X1
19	9597.XP_003813274.1	0.600	Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
20	9597.XP_008972163.1	0.600	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 3 bases in 2 codons

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003777	0.999	microtubule motor activity
GO:0005488	0.961	binding
GO:0005515	0.944	protein binding
GO:0003824	0.441	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.939	cellular process
GO:0007018	0.897	microtubule-based movement
GO:0071840	0.772	cellular component organization or biogenesis
GO:0016043	0.756	cellular component organization
GO:0022607	0.726	cellular component assembly
GO:0003341	0.647	cilium movement
GO:0043933	0.626	protein-containing complex organization
GO:0006996	0.626	organelle organization
GO:0065003	0.555	protein-containing complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	0.998	cilium
GO:0005856	0.998	cytoskeleton
GO:0005737	0.995	cytoplasm
GO:0005875	0.988	microtubule associated complex
GO:1902494	0.936	catalytic complex
GO:0030286	0.915	dynein complex
GO:0099568	0.597	cytoplasmic region
GO:0032838	0.591	plasma membrane bounded cell projection cytoplasm
GO:0097014	0.417	ciliary plasm
GO:0005829	0.400	cytosol
GO:0005930	0.377	axoneme
GO:0005858	0.318	axonemal dynein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]