StarFunc result for job id Q6ZRF8

User Input

>input (634 residues)
MSGAIFGPLEGPSSLDAPSIHPLVCPLCHVQYERPCLLDCFHDFCAGCLRGRATDGRLTC
PLCQHQTVLKGPSGLPPVDRLLQFLVDSSGDGVEAVRCANCDLECSEQDVETTYFCNTCG
QPLCARCRDETHRARMFARHDIVALGQRSRDVPQKCTLHAEPYLLFSTDKKLLLCIRCFR
DMQKESRAHCVDLESAYVQGCERLEQAVLAVKALQTATREAIALLQAMVEEVRHSAAEEE
DAIHALFGSMQDRLAERKALLLQAVQSQYEEKDKAFKEQLSHLATLLPTLQVHLVICSSF
LSLANKAEFLDLGYELMERLQGIVTRPHHLRPIQSSKIASDHRAEFARCLEPLLLLGPRR
VAAAASGANTLAGGLGPKALTGPHCPSPVGKMSGSPVQKPTLHRSISTKVLLAEGENTPF
AEHCRHYEDSYRHLQAEMQSLKDQVQELHRDLTKHHSLIKAEIMGDVLHKSLQLDVQIAS
EHASLEGMRVVFQEIWEEAYQRVANEQEIYEAQLHDLLQLRQENAYLTTITKQITPYVRS
IAKVKERLEPRFQAPVDEQSESLQNTHDDSRNNAASARNNPGSVPEKREKTSEPKGNSWA
PNGLSEEPLLKNMDHHRSKQKNGGDVPTWREHPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZRF8	1.000	1.000	1.420E-99	634	1.000	1.000	Q6ZRF8.pdb.gz	RN207_HUMAN RING finger protein 207 OS=Homo sapiens OX=9606 GN=RNF207 PE=1 SV=2
2	AFDB:E9QHE3	0.649	0.649	7.753E-65	634	0.603	0.603	E9QHE3.pdb.gz	RN207_DANRE RING finger protein 207 OS=Danio rerio OX=7955 GN=rnf207b PE=3 SV=1
3	AFDB:M9PH32	0.403	0.228	2.449E-14	1206	0.164	0.086	M9PH32.pdb.gz	M9PH32_DROME Meiotic P26, isoform C OS=Drosophila melanogaster OX=7227 GN=mei-P26 PE=1 SV=1
4	AFDB:Q6E2N3	0.351	0.215	1.235E-13	1163	0.161	0.088	Q6E2N3.pdb.gz	TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio OX=7955 GN=trim33 PE=2 SV=1
5	AFDB:Q9H8W5	0.327	0.350	1.851E-13	580	0.123	0.134	Q9H8W5.pdb.gz	TRI45_HUMAN E3 ubiquitin-protein ligase TRIM45 OS=Homo sapiens OX=9606 GN=TRIM45 PE=1 SV=2
6	AFDB:Q80VI1	0.298	0.268	2.471E-13	734	0.142	0.123	Q80VI1.pdb.gz	TRI56_MOUSE E3 ubiquitin-protein ligase TRIM56 OS=Mus musculus OX=10090 GN=Trim56 PE=1 SV=1
7	AFDB:Q60953	0.321	0.246	6.993E-13	885	0.161	0.115	Q60953.pdb.gz	PML_MOUSE Protein PML OS=Mus musculus OX=10090 GN=Pml PE=1 SV=3
8	AFDB:Q8C7M3	0.313	0.254	9.337E-13	817	0.134	0.104	Q8C7M3.pdb.gz	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
9	AFDB:Q6PFY8	0.322	0.343	1.664E-12	580	0.118	0.129	Q6PFY8.pdb.gz	TRI45_MOUSE E3 ubiquitin-protein ligase TRIM45 OS=Mus musculus OX=10090 GN=Trim45 PE=2 SV=2
10	AFDB:Q9UJV3	0.311	0.277	2.222E-12	735	0.126	0.109	Q9UJV3.pdb.gz	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
11	PDB:7z36B	0.224	0.301	8.609E-6	446	0.079	0.112	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
12	PDB:4r8pL	0.103	0.238	5.904E-3	254	0.041	0.102	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:4tn3B	0.227	0.365	5.904E-3	362	0.041	0.072	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
14	PDB:5dkaA	0.087	0.460	1.671E-2	96	0.036	0.240	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:5gm6a	0.089	0.409	9.461E-2	123	0.030	0.154	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:7oniH	0.082	0.129	2.677E-1	380	0.082	0.137	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
17	PDB:7qcdC	0.093	0.211	4.251E-1	267	0.021	0.049	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
18	PDB:7y4sA	0.149	0.249	4.772E-1	343	0.052	0.096	7y4sA.pdb.gz
19	PDB:4kblA	0.069	0.105	5.676E-1	395	0.044	0.071	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
20	PDB:7oikA	0.093	0.014	6.750E-1	4426	0.027	0.004	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QHE3	0.0	780	634	0.609	0.609	RN207_DANRE RING finger protein 207 OS=Danio rerio OX=7955 GN=rnf207b PE=3 SV=1
2	Q6ZRF8	0.0	1308	634	1.000	1.000	RN207_HUMAN RING finger protein 207 OS=Homo sapiens OX=9606 GN=RNF207 PE=1 SV=2
3	Q91ZY8	4.73e-12	71.6	710	0.115	0.103	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
4	Q9C026	4.73e-12	71.6	710	0.115	0.103	TRIM9_HUMAN E3 ubiquitin-protein ligase TRIM9 OS=Homo sapiens OX=9606 GN=TRIM9 PE=1 SV=1
5	Q8C7M3	5.01e-12	71.6	817	0.115	0.089	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
6	F1QFW2	8.03e-10	64.3	744	0.132	0.113	F1QFW2_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim2 PE=3 SV=1
7	Q58ER5	1.09e-09	63.9	744	0.132	0.113	Q58ER5_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=zgc:113099 PE=2 SV=1
8	M9MRI4	4.52e-09	62.0	740	0.117	0.100	TRIM9_DROME E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1
9	Q9C040	5.87e-09	61.6	744	0.117	0.099	TRIM2_HUMAN Tripartite motif-containing protein 2 OS=Homo sapiens OX=9606 GN=TRIM2 PE=1 SV=1
10	Q9ESN6	1.31e-08	60.5	744	0.117	0.099	TRIM2_MOUSE Tripartite motif-containing protein 2 OS=Mus musculus OX=10090 GN=Trim2 PE=1 SV=1
11	D3ZQG6	1.63e-08	60.1	744	0.117	0.099	TRIM2_RAT Tripartite motif-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Trim2 PE=1 SV=2
12	A0A0D9RNP7	3.16e-08	59.3	819	0.123	0.095	A0A0D9RNP7_CHLSB PML nuclear body scaffold OS=Chlorocebus sabaeus OX=60711 GN=PML PE=4 SV=1
13	M9PH32	1.59e-07	57.0	1206	0.069	0.036	M9PH32_DROME Meiotic P26, isoform C OS=Drosophila melanogaster OX=7227 GN=mei-P26 PE=1 SV=1
14	Q9W378	1.69e-07	57.0	1189	0.069	0.037	Q9W378_DROME FI01101p OS=Drosophila melanogaster OX=7227 GN=mei-P26 PE=2 SV=1
15	Q9Y111	1.77e-07	57.0	1189	0.069	0.037	Q9Y111_DROME BcDNA.GH10646 OS=Drosophila melanogaster OX=7227 GN=mei-P26 PE=2 SV=1
16	Q60953	3.29e-07	56.2	885	0.144	0.103	PML_MOUSE Protein PML OS=Mus musculus OX=10090 GN=Pml PE=1 SV=3
17	O75382	5.89e-07	55.1	744	0.123	0.105	TRIM3_HUMAN Tripartite motif-containing protein 3 OS=Homo sapiens OX=9606 GN=TRIM3 PE=1 SV=2
18	Q9R1R2	6.47e-07	55.1	744	0.123	0.105	TRIM3_MOUSE Tripartite motif-containing protein 3 OS=Mus musculus OX=10090 GN=Trim3 PE=1 SV=1
19	O70277	8.67e-07	54.7	744	0.128	0.109	TRIM3_RAT Tripartite motif-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Trim3 PE=1 SV=1
20	Q80VI1	3.13e-06	52.8	734	0.142	0.123	TRI56_MOUSE E3 ubiquitin-protein ligase TRIM56 OS=Mus musculus OX=10090 GN=Trim56 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03915 AIP3	0.073	23.8	Actin interacting protein 3
2	PF07889 DUF1664	39	15.7	Protein of unknown function (DUF1664)
3	PF12126 DUF3583	0.04	24.9	Protein of unknown function (DUF3583)
4	PF01485 IBR	55	15.3	IBR domain, a half RING-finger domain
5	PF00726 IL10	74	14.3	Interleukin 10
6	PF13899 Thioredoxin_7	1.1e+02	14.4	Thioredoxin-like
7	PF00643 zf-B_box	8.5e-05	33.9	B-box zinc finger
8	PF00097 zf-C3HC4	0.35	22.1	Zinc finger, C3HC4 type (RING finger)
9	PF14634 zf-RING_5	8.3	17.8	zinc-RING finger domain
10	PF13445 zf-RING_UBOX	20	16.6	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367173

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355133	0.696	Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
2	9606.ENSP00000262186	0.637	Potassium voltage-gated channel subfamily H member 2
3	9606.ENSP00000297632	0.597	Transmembrane protein 65
4	9606.ENSP00000377823	0.592	Protein NDRG4
5	9606.ENSP00000401018	0.556	GINS complex subunit 3
6	9606.ENSP00000417914	0.551	Ankyrin repeat and SOCS box protein 11
7	9606.ENSP00000459533	0.520	Lipopolysaccharide-induced tumor necrosis factor-alpha factor
8	9606.ENSP00000356790	0.507	Sodium/potassium-transporting ATPase subunit beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0051087	0.991	chaperone binding
GO:0044325	0.991	transmembrane transporter binding
GO:0030544	0.991	Hsp70 protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0051049	0.959	regulation of transport
GO:0042391	0.945	regulation of membrane potential
GO:1904062	0.944	regulation of monoatomic cation transmembrane transport
GO:0010959	0.936	regulation of metal ion transport
GO:0048518	0.934	positive regulation of biological process
GO:0048522	0.920	positive regulation of cellular process
GO:0098900	0.891	regulation of action potential
GO:0065009	0.883	regulation of molecular function
GO:0060255	0.859	regulation of macromolecule metabolic process
GO:1901381	0.849	positive regulation of potassium ion transmembrane transport
GO:0009987	0.817	cellular process
GO:0044093	0.799	positive regulation of molecular function
GO:1901016	0.771	regulation of potassium ion transmembrane transporter activity
GO:0010468	0.743	regulation of gene expression
GO:2001257	0.719	regulation of cation channel activity
GO:1901018	0.694	positive regulation of potassium ion transmembrane transporter activity
GO:2001259	0.640	positive regulation of cation channel activity
GO:0009893	0.420	positive regulation of metabolic process
GO:0010604	0.357	positive regulation of macromolecule metabolic process
GO:0060306	0.336	regulation of membrane repolarization
GO:0060307	0.323	regulation of ventricular cardiac muscle cell membrane repolarization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0048471	0.902	perinuclear region of cytoplasm
GO:0043226	0.746	organelle
GO:0043231	0.724	intracellular membrane-bounded organelle
GO:0005829	0.537	cytosol
GO:0071944	0.515	cell periphery
GO:0005886	0.492	plasma membrane
GO:0032991	0.384	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]