StarFunc result for job id Q6ZRH7

User Input

>input (1159 residues)
MCGPAMFPAGPPWPRVRVVQVLWALLAVLLASWRLWAIKDFQECTWQVVLNEFKRVGESG
VSDSFFEQEPVDTVSSLFHMLVDSPIDPSEKYLGFPYYLKINYSCEEKPSEDLVRMGHLT
GLKPLVLVTFQSPVNFYRWKIEQLQIQMEAAPFRSKEPCMAEEVCSMSWYTPMPIKKGSV
VMRVDISSNGLGTFIPDKRFQMNINGFLKRDRDNNIQFTVGEELFNLMPQYFVGVSSRPL
WHTVDQSPVLILGGIPNEKYVLMTDTSFKDFSLVELSIDSCWVGSFYCPHSGFTATIYDT
IATESTLFIRQNQLVYYFTGTYTTLYERNRGSGSWIRVLASECIKKLCPVYFHSNGSEYI
MALTTGKHEGYVHFGTIRDGQVSFEMLPRQWSVCEQIGVTTCSIIWSEYIAGEYTLLLLV
ESGYGNASKRFQVVSYNTASDDLELLYHIPEFIPEARGLEFLMILGTESYTSTAMAPKGI
FCNPYNNLIFIWGNFLLQSSNKENFIYLADFPKELSIKYMARSFRGAVAIVTETEEIWYL
LEGSYRVYQLFPSKGWQVHISLKLMQQSSLYASNETMLTLFYEDSKLYQLVYLMNNQKGQ
LVKRLVPVEQLLMYQQHTSHYDLERKGGYLMLSFIDFCPFSVMRLRSLPSPQRYTRQERY
RARPPRVLERSGFHNENSLAIYQGLVYYLLWLHSVYDKPYADPVHDPTWRWWANNKQDQD
YYFFLASNWRSAGGVSIEMDSYEKIYNLESAYELPERIFLDKGTEYSFAIFLSAQGHSFR
TQSELGTAFQLHSQVDVGVVLADPGCIEASVKQEVLINRNSVLFSITLKDKKLCYDQGIS
GHHLMETSMTVNVVGSSGLCFQETHLGPHMQGNLMVPVFIGCPPGKRLAFDITYTLEYSR
LKNKHYFDCVNVNPEMPCFLFRDIFYPFFLIQDLVTGDSGSFQGSYVLLVVGGGPTLDSL
KDYSEDEIYRFNSPLDKTNSLIWTTRTTRTTKDSAFHIMSHESPGIEWLCLENAPCYDNV
PQGIFAPEFFFKVLVSNRGVDTSTYCNYQLTFLLHIHGLPLSPKRALFIIMVSASVFVGL
VIFYIAFCLLWPLVVKGCTMIRWKINNLIASESYYTYASISGISSMPSLRHSRMGSMFSS
RMTEDRAEPKEAVERQLMT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:C6KI89	0.902	0.912	0.000	1145	0.555	0.562	C6KI89.pdb.gz	CTSG2_MOUSE Cation channel sperm-associated auxiliary subunit gamma 2 OS=Mus musculus OX=10090 GN=Catsperg2 PE=1 SV=1
2	AFDB:Q6ZRH7	1.000	1.000	0.000	1159	1.000	1.000	Q6ZRH7.pdb.gz	CTSRG_HUMAN Cation channel sperm-associated auxiliary subunit gamma OS=Homo sapiens OX=9606 GN=CATSPERG PE=2 SV=3
3	PDB:7eebE	0.431	0.466	1.680E-20	1053	0.117	0.129	7eebE.pdb.gz	Structure of a mammalian sperm cation channel complex.
4	AFDB:Q93033	0.071	0.078	4.237E-9	1021	0.104	0.119	Q93033.pdb.gz	IGSF2_HUMAN Immunoglobulin superfamily member 2 OS=Homo sapiens OX=9606 GN=CD101 PE=1 SV=2
5	PDB:5gqtA	0.149	0.303	1.672E-7	470	0.053	0.130	5gqtA.pdb.gz
6	AFDB:P98163	0.103	0.064	2.186E-7	1984	0.052	0.030	P98163.pdb.gz	YL_DROME Putative vitellogenin receptor OS=Drosophila melanogaster OX=7227 GN=yl PE=1 SV=2
7	PDB:7mq8LO	0.083	0.106	2.636E-7	848	0.036	0.050	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:7mqaLO	0.080	0.108	2.636E-7	819	0.035	0.050	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:7mq8LT	0.104	0.132	4.370E-7	869	0.054	0.072	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:7mq8LS	0.185	0.421	5.627E-7	453	0.035	0.088	7mq8LS.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:7d4iBE	0.185	0.235	9.328E-7	890	0.038	0.049	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
12	AFDB:A0A0R4INC0	0.125	0.164	1.102E-6	840	0.070	0.096	A0A0R4INC0.pdb.gz
13	AFDB:A1Z9X4	0.075	0.072	1.493E-6	1235	0.092	0.087	A1Z9X4.pdb.gz	A1Z9X4_DROME Hibris, isoform B OS=Drosophila melanogaster OX=7227 GN=hbs PE=4 SV=1
14	PDB:7z8bF	0.199	0.433	1.893E-6	457	0.036	0.092	7z8bF.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
15	PDB:8ajmB	0.182	0.459	1.991E-6	395	0.027	0.078	8ajmB.pdb.gz	Recognition of the CCT5 di-Glu degron by CRL4 DCAF12 is dependent on TRiC assembly.
16	AFDB:Q5U3Q5	0.143	0.179	2.880E-6	897	0.039	0.050	Q5U3Q5.pdb.gz	Q5U3Q5_DANRE Transducin beta-like protein 3 OS=Danio rerio OX=7955 GN=zgc:101778 PE=1 SV=1
17	PDB:7mq8LH	0.122	0.171	3.301E-6	746	0.042	0.066	7mq8LH.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	AFDB:P01132	0.138	0.132	3.708E-6	1217	0.080	0.076	P01132.pdb.gz	EGF_MOUSE Pro-epidermal growth factor OS=Mus musculus OX=10090 GN=Egf PE=1 SV=2
19	AFDB:Q3U0P1	0.134	0.139	4.103E-6	1104	0.051	0.053	Q3U0P1.pdb.gz	PALB2_MOUSE Partner and localizer of BRCA2 OS=Mus musculus OX=10090 GN=Palb2 PE=1 SV=2
20	AFDB:Q96JA1	0.077	0.081	4.775E-6	1093	0.041	0.044	Q96JA1.pdb.gz	LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens OX=9606 GN=LRIG1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C6KI89	0.0	1355	1145	0.557	0.563	CTSG2_MOUSE Cation channel sperm-associated auxiliary subunit gamma 2 OS=Mus musculus OX=10090 GN=Catsperg2 PE=1 SV=1
2	Q6ZRH7	0.0	2412	1159	1.000	1.000	CTSRG_HUMAN Cation channel sperm-associated auxiliary subunit gamma OS=Homo sapiens OX=9606 GN=CATSPERG PE=2 SV=3
3	Q582P0	1.9	35.4	1594	0.016	0.012	Q582P0_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.730 PE=3 SV=1
4	B2RUJ5	5.6	33.5	842	0.027	0.037	APBA1_MOUSE Amyloid-beta A4 precursor protein-binding family A member 1 OS=Mus musculus OX=10090 GN=Apba1 PE=1 SV=2
5	Q8IDW3	7.4	33.1	632	0.022	0.041	Q8IDW3_PLAF7 tryptophan--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1336900 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15064 CATSPERG	0	1865.6	Cation channel sperm-associated protein subunit gamma

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386962

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309052	0.979	Cation channel sperm-associated protein 1
2	9606.ENSP00000371037	0.945	Cation channel sperm-associated protein subunit delta
3	9606.ENSP00000256343	0.936	Cation channel sperm-associated protein subunit beta
4	9606.ENSP00000390423	0.928	Cation channel sperm-associated protein 4
5	9606.ENSP00000282611	0.896	Cation channel sperm-associated protein 3
6	9606.ENSP00000371180	0.867	Cation channel sperm-associated protein 2
7	9606.ENSP00000360423	0.795	Voltage-dependent N-type calcium channel subunit alpha-1B
8	9606.ENSP00000334198	0.789	Voltage-dependent T-type calcium channel subunit alpha-1H
9	9606.ENSP00000266376	0.784	Voltage-dependent L-type calcium channel subunit alpha-1C
10	9606.ENSP00000321617	0.771	Ankyrin repeat and zinc finger domain-containing protein 1
11	9606.ENSP00000005284	0.763	Voltage-dependent calcium channel gamma-3 subunit
12	9606.ENSP00000355192	0.754	Voltage-dependent L-type calcium channel subunit alpha-1S
13	9606.ENSP00000288139	0.746	Voltage-dependent L-type calcium channel subunit alpha-1D
14	9606.ENSP00000355492	0.740	Cation channel sperm-associated protein subunit epsilon
15	9606.ENSP00000365441	0.740	Voltage-dependent L-type calcium channel subunit alpha-1F
16	9606.ENSP00000356545	0.736	Voltage-dependent R-type calcium channel subunit alpha-1E
17	9606.ENSP00000226021	0.720	Voltage-dependent calcium channel gamma-1 subunit
18	9606.ENSP00000252729	0.720	Voltage-dependent calcium channel gamma-6 subunit
19	9606.ENSP00000262138	0.720	Voltage-dependent calcium channel gamma-4 subunit
20	9606.ENSP00000270458	0.720	Voltage-dependent calcium channel gamma-8 subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0032502	0.986	developmental process
GO:0050794	0.979	regulation of cellular process
GO:0032501	0.974	multicellular organismal process
GO:0048856	0.811	anatomical structure development
GO:0030154	0.640	cell differentiation
GO:0023052	0.596	signaling
GO:0007154	0.578	cell communication
GO:0050896	0.524	response to stimulus
GO:0000003	0.494	reproduction
GO:0048468	0.384	cell development
GO:0048469	0.359	cell maturation
GO:0051716	0.327	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.862	protein-containing complex
GO:1990351	0.823	transporter complex
GO:0098797	0.815	plasma membrane protein complex
GO:0034703	0.805	cation channel complex
GO:0043226	0.739	organelle
GO:0043227	0.703	membrane-bounded organelle
GO:0034704	0.661	calcium channel complex
GO:0005891	0.642	voltage-gated calcium channel complex
GO:0005622	0.537	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]