StarFunc result for job id Q6ZRI0

User Input

>input (1400 residues)
MGVLASALCWLLCVWLPWGEQAAESLRVQRLGERVVDSGRSGARGMRNVKGMRNGPAQTR
VSSSSSHQEATLAMGDKATVVGGQQAEAPDSVAMSSWERRLHRAKCAPSYLFSCFNGGEC
VHPAFCDCRRFNATGPRCQMVYNAGPERDSICRAWGQHHVETFDGLYYYLSGKGSYTLVG
RHEPEGQSFSIQVHNDPQCGSSPYTCSRAVSLFFVGEQEIHLAKEVTHGGMRVQLPHVMG
SARLQQLAGYVIVRHQSAFTLAWDGASAVYIKMSPELLGWTHGLCGNNNADPKDDLVTSS
GKLTDDVVEFVHSWQEQAPNQPPGPTTSSLPRPPCLQQNPGTMQGVYEQCEALLRPPFDA
CHAYVSPLPFTASCTSDLCQSMGDVATWCRALAEYARACAQAGRPLQGWRTQLRQCTVHC
KEKAFTYNECIACCPASCHPRASCVDSEIACVDGCYCPNGLIFEDGGCVAPAECPCEFHG
TLYPPGSVVKEDCNTCTCTSGKWECSTAVCPAECSVTGDIHFTTFDGRRYTFPATCQYIL
AKSRSSGTFTVTLQNAPCGLNQDGACVQSVSVILHQDPRRQVTLTQAGDVLLFDQYKIIP
PYTDDAFEIRRLSSVFLRVRTNVGVRVLYDREGLRLYLQVDQRWVEDTVGLCGTFNGNTQ
DDFLSPVGVPESTPQLFGNSWKTLSACSPLVSGSPLDPCDVHLQAASYSVQACSVLTGEM
FAPCSAFLSPVPYFEQCRRDACRCGQPCLCATLAHYAHLCRRHGLPVDFRARLPACALSC
EASKEYSPCVAPCGRTCQDLASPEACGVDGGDDLSRDECVEGCACPPDTYLDTQADLCVP
RNQCSCHFQGVDYPPGDSDIPSLGHCHCKDGVMSCDSRAPAAACPAGQVFVNCSDLHTDL
ELSRERTCEQQLLNLSVSARGPCLSGCACPQGLLRHGDACFLPEECPCTWKGKEYFPGDQ
VMSPCHTCVCQRGSFQCTLHPCASTCTAYGDRHYRTFDGLPFDFVGACKVHLVKSTSDVS
FSVIVENVNCYSSGMICRKFISINVGNSLIVFDDDSGNPSPESFLDDKQEVHTWRVGFFT
LVHFPQEHITLLWDQRTTVHVQAGPQWQGQLAGLCGNFDLKTINEMRTPENLELTNPQEF
GSSWAAVECPDTLDPRDMCVLNPLREPFAKKECSILLSEVFEICHPVVDVTWFYSNCLTD
TCGCSQGGDCECFCASVSAYAHQCCQHGVAVDWRTPRLCPYDCDFFNKVLGKGPYQLSSL
AAGGALVGMKAVGDDIVLVRTEDVAPADIVSFLLTAALYKAKAHDPDVVSLEAADRPNFF
LHVTANGSLELAKWQGRDTFQQHASFLLHRGTRQAGLVALESLAKPSSFLYVSGAVLALR
LYEHTEVFRRGTLFRLLDAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A286YAF1	0.431	0.291	0.000	2146	0.382	0.249	A0A286YAF1.pdb.gz
2	AFDB:Q3ZCN5	0.497	0.307	0.000	2332	0.383	0.230	Q3ZCN5.pdb.gz	OTOGL_HUMAN Otogelin-like protein OS=Homo sapiens OX=9606 GN=OTOGL PE=1 SV=6
3	AFDB:A0A0G2K1Y4	0.636	0.792	3.984E-86	1103	0.248	0.315	A0A0G2K1Y4.pdb.gz	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
4	AFDB:Q98UI9	0.650	0.446	5.066E-86	2108	0.251	0.167	Q98UI9.pdb.gz	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
5	AFDB:Q6W4X9	0.650	0.391	1.728E-79	2439	0.245	0.141	Q6W4X9.pdb.gz	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
6	AFDB:F1NBL0	0.626	0.728	4.556E-77	1185	0.233	0.275	F1NBL0.pdb.gz	MUC6_CHICK Mucin-6 (Fragment) OS=Gallus gallus OX=9031 GN=MUC6 PE=1 SV=1
7	AFDB:Q28983	0.218	0.128	5.909E-61	2476	0.217	0.123	Q28983.pdb.gz	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
8	AFDB:E9Q0B5	0.213	0.120	1.291E-57	2583	0.222	0.120	E9Q0B5.pdb.gz	E9Q0B5_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
9	AFDB:F1QK57	0.210	0.138	3.557E-56	2201	0.209	0.133	F1QK57.pdb.gz
10	AFDB:Q3U492	0.190	0.173	2.180E-24	1550	0.091	0.082	Q3U492.pdb.gz	KCP_MOUSE Kielin/chordin-like protein OS=Mus musculus OX=10090 GN=Kcp PE=1 SV=2
11	PDB:2d43A	0.097	0.257	2.033E-6	482	0.034	0.100	2d43A.pdb.gz	The family 42 carbohydrate-binding module of family 54 alpha-L-arabinofuranosidase specifically binds the arabinofuranose side chain of hemicellulose
12	PDB:3v0aB	0.094	0.111	3.301E-5	1150	0.029	0.035	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
13	PDB:4qd2C	0.101	0.428	4.849E-5	286	0.021	0.105	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
14	PDB:6z3mc	0.084	0.597	1.152E-4	158	0.015	0.133	6z3mc.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
15	PDB:1md6A	0.089	0.673	1.537E-4	154	0.014	0.123	1md6A.pdb.gz
16	PDB:4qd2B	0.087	0.700	5.901E-4	143	0.014	0.140	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
17	PDB:4izeA	0.085	0.628	9.095E-4	152	0.019	0.171	4izeA.pdb.gz
18	PDB:6hpiA	0.084	0.577	9.095E-4	158	0.020	0.177	6hpiA.pdb.gz
19	PDB:1t9fA	0.086	0.533	1.471E-3	178	0.019	0.152	1t9fA.pdb.gz
20	PDB:5bowA	0.089	0.675	1.699E-3	151	0.015	0.139	5bowA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O55225	0.0	2465	2911	0.836	0.402	OTOG_MOUSE Otogelin OS=Mus musculus OX=10090 GN=Otog PE=1 SV=3
2	Q3ZCN5	0.0	1100	2353	0.376	0.224	OTOGL_HUMAN Otogelin-like protein OS=Homo sapiens OX=9606 GN=OTOGL PE=1 SV=6
3	P04275	4.12e-178	590	2813	0.281	0.140	VWF_HUMAN von Willebrand factor OS=Homo sapiens OX=9606 GN=VWF PE=1 SV=4
4	Q62635	1.55e-172	557	1513	0.255	0.236	MUC2_RAT Mucin-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc2 PE=1 SV=1
5	Q8CIZ8	1.79e-172	574	2813	0.271	0.135	VWF_MOUSE von Willebrand factor OS=Mus musculus OX=10090 GN=Vwf PE=1 SV=2
6	E7F9Z1	9.53e-172	572	2812	0.261	0.130	E7F9Z1_DANRE von Willebrand factor OS=Danio rerio OX=7955 GN=VWF PE=1 SV=3
7	Q02817	1.27e-167	561	5179	0.259	0.070	MUC2_HUMAN Mucin-2 OS=Homo sapiens OX=9606 GN=MUC2 PE=1 SV=3
8	Q80Z19	5.90e-164	549	2680	0.254	0.132	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
9	E9QAQ8	2.54e-163	548	3455	0.265	0.107	E9QAQ8_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=5
10	E9PWB6	5.97e-162	543	2751	0.265	0.135	E9PWB6_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=1
11	P98088	3.62e-161	541	5654	0.271	0.067	MUC5A_HUMAN Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 SV=4
12	Q8BYW0	9.20e-159	519	1477	0.250	0.237	Q8BYW0_MOUSE VWFD domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
13	Q9ESP3	1.60e-158	526	1851	0.259	0.196	Q9ESP3_RAT Mucin (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=2 SV=1
14	A0A0G2K1Y4	9.64e-155	522	3586	0.259	0.101	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
15	A0A0G2K8X5	1.04e-154	522	3922	0.259	0.092	A0A0G2K8X5_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
16	Q98UI9	1.53e-152	512	2108	0.241	0.160	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
17	F1NBL0	9.98e-152	493	1185	0.241	0.285	MUC6_CHICK Mucin-6 (Fragment) OS=Gallus gallus OX=9031 GN=MUC6 PE=1 SV=1
18	E9Q5I3	1.67e-151	513	4800	0.250	0.073	E9Q5I3_MOUSE Mucin 5, subtype B, tracheobronchial OS=Mus musculus OX=10090 GN=Muc5b PE=1 SV=1
19	Q8K1G6	1.06e-150	511	4782	0.249	0.073	Q8K1G6_MOUSE Muc5b protein OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
20	M9PCE5	5.90e-150	508	3842	0.254	0.093	M9PCE5_DROME Hemolectin, isoform B OS=Drosophila melanogaster OX=7227 GN=Hml PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05270 AbfB	0.0015	30.0	Alpha-L-arabinofuranosidase B (ABFB) domain
2	PF08742 C8	3.6e-40	147.4	C8 domain
3	PF05375 Pacifastin_I	0.024	25.7	Pacifastin inhibitor (LCMII)
4	PF01826 TIL	1.3e-10	52.6	Trypsin Inhibitor like cysteine rich domain
5	PF00093 VWC	0.033	25.8	von Willebrand factor type C domain
6	PF00094 VWD	8e-98	336.6	von Willebrand factor type D domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382323

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358430	0.933	Beta-tectorin
2	9606.ENSP00000373610	0.920	Otoancorin
3	9606.ENSP00000296358	0.770	Otopetrin-1
4	9606.ENSP00000005226	0.755	Harmonin
5	9606.ENSP00000254627	0.736	Otoconin 90
6	9606.ENSP00000262283	0.736	Otoconin-90
7	9606.ENSP00000401513	0.735	Stereocilin
8	9606.ENSP00000330808	0.712	Otolin-1
9	9606.ENSP00000273353	0.706	Myosin-15
10	9606.ENSP00000265965	0.700	Secretion-regulating guanine nucleotide exchange factor
11	9606.ENSP00000466561	0.696	Carcinoembryonic antigen-related cell adhesion molecule 16
12	9606.ENSP00000303960	0.673	ATP-binding cassette sub-family C member 8
13	9606.ENSP00000205890	0.644	Unconventional myosin-XV
14	9606.ENSP00000379862	0.627	Cochlin
15	9606.ENSP00000372295	0.606	Gap junction beta-2 protein
16	9606.ENSP00000306010	0.600	ADP-ribosylation factor 4
17	9606.ENSP00000358994	0.600	Unconventional myosin-VI
18	9606.ENSP00000367214	0.588	Glutaredoxin domain-containing cysteine-rich protein 2
19	9606.ENSP00000382090	0.581	Claudin-14
20	9606.ENSP00000000233	0.566	ADP-ribosylation factor 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.997	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007605	0.953	sensory perception of sound
GO:0007610	0.731	behavior
GO:0008344	0.688	adult locomotory behavior

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.998	cell periphery
GO:0005737	0.986	cytoplasm
GO:0030312	0.852	external encapsulating structure
GO:0031012	0.779	extracellular matrix
GO:0005829	0.752	cytosol
GO:0005615	0.552	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]