StarFunc result for job id Q6ZRI6

User Input

>input (1047 residues)
MAEKRPLRTLGPVMYGKLPRLETDSGLEHSLPHSVGNQDPCTYKGSYFSCPMAGTPKAES
EQLASWTPYPPLYSTGMAGPPLQADNLLTNCLFYRSPAEGPEKMQDSSPVELLPFSPQAH
SYPGPPLAAPKPVYRNPLCYGLSTCLGEGAVKRPLDVDWTLATGPLLPSADPPCSLAPAP
SKGQTLDGTFLRGVPAEGSSKDSSGSFSPCQPFLEKYQTIHSTGFLASRYTGPYPRNSKQ
AMSEGPSSPWTQLAQPLGPPCQDTGPTHYPPPHHPPPHPPQALPCPPACRHPEKQGSYSP
ALPLQPLGGHKGTGYQAGGLGSPYLRQQAAQAPYIPPLGLDAYPYPSAPLPAPSPGLKLE
PPLTPRCPLDFAPQTLSFPYARDDLSLYGASPGLGGTPPSQNNVRAVPQPGAFQRACQPL
PASQPCSEPVRPAQEAEEKTWLPSCRKEKLQPRLSEHSGPPIVIRDSPVPCTPPALPPCA
RECQSLPQKEGARPPSSPPMPVIDNVFSLAPYRDYLDVPAPEATTEPDSATAEPDSAPAT
SEGQDKGCRGTLPAQEGPSGSKPLRGSLKEEVALDLSVRKPTAEASPVKASRSVEHAKPT
AAMDVPDVGNMVSDLPGLKKIDTEAPGLPGVPVTTDAMPRTNFHSSVAFMFRKFKILRPA
PLPAAVVPSTPTSAPAPTQPAPTPTSGPIGLRILAQQPLSVTCFSLALPSPPAVAVASPA
PAPAPSPAPARAQAPASARDPAPAPAPVAGPAPASTSAPGDSLEQHFTGLHASLCDAISG
SVAHSPPEKLREWLETAGPWGQAAWQDCQGVQGLLAKLLSQLQRFDRTHRCPFPHVVRAG
AIFVPIHLVKERLFPRLPPASVDHVLQEHRVELRPTTLSEERALRELALPGCTSRMLKLL
ALRQLPDIYPDLLGLQWRDCVRRQLGDFDTEAGAVSSSEPTVARGEPESLALAQKSPAPK
VRKPGRKPPTPGPEKAEAAAGEESCGASPTPATSASPPGPTLKARFRSLLETAWLNGLAL
PTWGHKSSRPDQPSPCPQLLDSQSHHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZRI6	1.000	1.000	0.000	1047	1.000	1.000	Q6ZRI6.pdb.gz	CO039_HUMAN Uncharacterized protein C15orf39 OS=Homo sapiens OX=9606 GN=C15orf39 PE=1 SV=3
2	AFDB:O95886	0.059	0.062	4.211E-4	979	0.168	0.180	O95886.pdb.gz	DLGP3_HUMAN Disks large-associated protein 3 OS=Homo sapiens OX=9606 GN=DLGAP3 PE=1 SV=3
3	AFDB:Q8BI84	0.066	0.041	3.757E-3	1930	0.144	0.078	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
4	AFDB:Q9W523	0.039	0.030	4.203E-3	1537	0.139	0.095	Q9W523.pdb.gz	Q9W523_DROME Polyhomeotic distal, isoform A OS=Drosophila melanogaster OX=7227 GN=ph-d PE=4 SV=3
5	AFDB:Q5SW79	0.048	0.038	7.368E-3	1584	0.142	0.094	Q5SW79.pdb.gz	CE170_HUMAN Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
6	AFDB:B1AZP2	0.064	0.066	9.222E-3	992	0.146	0.154	B1AZP2.pdb.gz	DLGP4_MOUSE Disks large-associated protein 4 OS=Mus musculus OX=10090 GN=Dlgap4 PE=1 SV=1
7	AFDB:P51825	0.060	0.063	9.754E-3	1210	0.173	0.150	P51825.pdb.gz	AFF1_HUMAN AF4/FMR2 family member 1 OS=Homo sapiens OX=9606 GN=AFF1 PE=1 SV=1
8	AFDB:P39769	0.043	0.038	1.091E-2	1589	0.145	0.096	P39769.pdb.gz	PHP_DROME Polyhomeotic-proximal chromatin protein OS=Drosophila melanogaster OX=7227 GN=ph-p PE=1 SV=2
9	AFDB:P51826	0.054	0.049	1.528E-2	1226	0.155	0.132	P51826.pdb.gz	AFF3_HUMAN AF4/FMR2 family member 3 OS=Homo sapiens OX=9606 GN=AFF3 PE=1 SV=3
10	AFDB:O88573	0.059	0.055	1.808E-2	1216	0.168	0.145	O88573.pdb.gz	AFF1_MOUSE AF4/FMR2 family member 1 OS=Mus musculus OX=10090 GN=Aff1 PE=1 SV=2
11	PDB:7q83D	0.052	0.198	8.269E-1	156	0.013	0.090	7q83D.pdb.gz
12	PDB:1a59A	0.056	0.124	9.251E-1	377	0.029	0.080	1a59A.pdb.gz	Structural adaptations of the cold-active citrate synthase from an Antarctic bacterium.
13	PDB:7lmaH	0.039	0.127	1.035	199	0.018	0.095	7lmaH.pdb.gz	Structures of telomerase at several steps of telomere repeat synthesis.
14	PDB:6jbjA	0.066	0.101	1.295	565	0.031	0.057	6jbjA.pdb.gz	Cryo-EM structure of human lysosomal cobalamin exporter ABCD4.
15	PDB:7et31	0.049	0.120	1.370	285	0.029	0.105	7et31.pdb.gz	Structural basis for genome packaging, retention, and ejection in human cytomegalovirus.
16	PDB:3c98B	0.053	0.172	1.715	230	0.024	0.109	3c98B.pdb.gz
17	PDB:1d2fB	0.054	0.114	1.814	368	0.016	0.046	1d2fB.pdb.gz	X-ray structure of MalY from Escherichia coli: a pyridoxal 5'-phosphate-dependent enzyme acting as a modulator in mal gene expression.
18	PDB:5kucA	0.047	0.098	2.030	402	0.021	0.055	5kucA.pdb.gz
19	PDB:5z62C	0.055	0.174	2.030	260	0.011	0.042	5z62C.pdb.gz	Structure of the intact 14-subunit human cytochrome c oxidase.
20	PDB:6nzzA	0.037	0.103	2.147	306	0.013	0.046	6nzzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H3BMJ2	0.0	1566	807	0.758	0.984	H3BMJ2_HUMAN Chromosome 15 open reading frame 39 (Fragment) OS=Homo sapiens OX=9606 GN=C15orf39 PE=1 SV=1
2	Q6ZRI6	0.0	2066	1047	1.000	1.000	CO039_HUMAN Uncharacterized protein C15orf39 OS=Homo sapiens OX=9606 GN=C15orf39 PE=1 SV=3
3	O60129	0.47	37.0	642	0.028	0.045	FKH2_SCHPO Fork head protein homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fkh2 PE=1 SV=1
4	Q685J3	1.1	35.8	4493	0.031	0.007	MUC17_HUMAN Mucin-17 OS=Homo sapiens OX=9606 GN=MUC17 PE=1 SV=2
5	P19246	5.5	33.5	1090	0.016	0.016	NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus OX=10090 GN=Nefh PE=1 SV=3
6	A0A096MKD4	6.6	33.1	707	0.024	0.035	A0A096MKD4_RAT LIM domain binding 3 OS=Rattus norvegicus OX=10116 GN=Ldb3 PE=1 SV=2
7	A0A0G2K2C4	7.5	33.1	679	0.024	0.037	A0A0G2K2C4_RAT LIM domain binding 3 OS=Rattus norvegicus OX=10116 GN=Ldb3 PE=1 SV=1
8	A0A8I5Y5H4	7.8	32.7	709	0.024	0.035	A0A8I5Y5H4_RAT LIM domain binding 3 OS=Rattus norvegicus OX=10116 GN=Ldb3 PE=1 SV=1
9	A0A096MJ01	8.3	32.7	771	0.024	0.032	A0A096MJ01_RAT LIM domain binding 3 OS=Rattus norvegicus OX=10116 GN=Ldb3 PE=1 SV=2
10	O75112	9.3	32.7	727	0.036	0.052	LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens OX=9606 GN=LDB3 PE=1 SV=2
11	A0A0G2JYM0	9.4	32.7	729	0.024	0.034	A0A0G2JYM0_RAT LIM domain binding 3 OS=Rattus norvegicus OX=10116 GN=Ldb3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17663 DUF5525	0	2034.1	Family of unknown function (DUF5525)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353854

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000243189	0.704	Arginine and serine rich protein 1
2	9606.ENSP00000334849	0.642	Transmembrane protein 104
3	9606.ENSP00000350260	0.556	Protein FAM219B
4	9606.ENSP00000370519	0.527	Arylsulfatase F
5	9606.ENSP00000457703	0.518	Ubiquitin-like protein 7
6	9606.ENSP00000290438	0.517	Golgin A6 family member A
7	9606.ENSP00000293851	0.503	Serine protease 33
8	9606.ENSP00000343617	0.501	Zinc finger protein 606

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0010468	0.995	regulation of gene expression
GO:0051252	0.994	regulation of RNA metabolic process
GO:0010556	0.987	regulation of macromolecule biosynthetic process
GO:0045934	0.979	negative regulation of nucleobase-containing compound metabolic process
GO:0006355	0.971	regulation of DNA-templated transcription
GO:0009987	0.928	cellular process
GO:0051253	0.848	negative regulation of RNA metabolic process
GO:0071704	0.770	organic substance metabolic process
GO:1902679	0.733	negative regulation of RNA biosynthetic process
GO:0006357	0.708	regulation of transcription by RNA polymerase II
GO:0045892	0.569	negative regulation of DNA-templated transcription
GO:0044238	0.515	primary metabolic process
GO:0044237	0.477	cellular metabolic process
GO:0006807	0.470	nitrogen compound metabolic process
GO:0000122	0.334	negative regulation of transcription by RNA polymerase II
GO:0043170	0.331	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.681	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]