StarFunc result for job id Q6ZRK6

User Input

>input (1079 residues)
MESNFNTESSSTFTLQSSSETLFSIQLLDFKTSLLEALEELRMRREAEIHYEEQIGKIIV
ETQELKWQKETLQNQKETLAEQHKEAMAVFKKQLQMKMCALEEEKGKYQLATEIKEKEIE
GLKETLKALQVSKYSLQKKVSEMEQKVQLHLLAKEDYHKQLSEIEKYYATITGQFGLVKE
NHEKLEQNVREAIQSNKRLSALNKKQEAEICSLKKELKKAASDLIKSKVTCQYKMGEENI
NLTIKEQKFQELQERLNMELELNEKINEEITHIQEEKQDIIISFQHMQQLLRQQIQANTE
MEAELKVLKENNQTLERDNELQREKVKENEEKFLNLQNEHEKALGTWKRHAEELNGEINK
IKNELSSLKETHIKLQEHYNKLCNQKTFEEDKKFQNVPEVNNENSEMSTEKSENTIIQKY
NTEQEIREENMENFCSDTEYREKEEKKEGSFIEEIIIDDLQLFEKSFKNEIDTVVSQDEN
QSEISLSKTLSLDKEVISQGQTSNVTDNRKSVTTEIKDKICLEKDNGCTEFKSPNNHFVV
LDTAIETEKIHLERTRGLDVHHTDVNLEVENNKTSFNSILNETAHNTYHNNNKDVSENEP
FKQFRLLPGTREHALEKEITNSDQTKADLDSSLDIKKNPVPCQKYSLRNSSNVMLDDKQC
KIKQIQLLTKKSECSILLSKQTSDFLQVCNDTLEKSELTVPCDIVIDHHVSYAAFSANSK
LLLKNSDKNVHSMSMLVKPNSSPGGKTMCKNMSDMQNSQFNNCLGYLENTNVNISHLHLN
NENSHASQAKDVKTAVHMKTCTETEFSNKKNQIDENQVTEATKNDLFLFVSINERQHTLL
NNTEKTESLNDIVSGKMFSEGQLEESHSFHIEPSGDLVNRSGRSTFDLSTSDKKTEKTPV
YMNFSDPGPWSKVNHIESQTASSSTPCISLLLKERPLDPSENKKIISMALCKNIGVDDVG
KDIGPDTTSINRVADTLNNWSIHPDPKGEPSEEKNAMAKTFYDSSFPTEHVKTKPLISTP
LQSHLQAIKTTKNTSGDDDWQSLITNQLNKSENLLSLENDNQPKKRKAEETLEKNNRLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4GYI3	0.116	0.134	1.586E-5	912	0.138	0.163	Q4GYI3.pdb.gz	Q4GYI3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3940 PE=4 SV=1
2	AFDB:F4HRT5	0.118	0.113	3.044E-5	1132	0.110	0.105	F4HRT5.pdb.gz	CRWN1_ARATH Protein CROWDED NUCLEI 1 OS=Arabidopsis thaliana OX=3702 GN=CRWN1 PE=1 SV=1
3	AFDB:A0A166B1A6	0.108	0.104	1.319E-4	1119	0.135	0.130	A0A166B1A6.pdb.gz	NMCP1_DAUCS Nuclear matrix constituent protein 1 OS=Daucus carota subsp. sativus OX=79200 GN=NMCP1 PE=1 SV=2
4	AFDB:Q14980	0.128	0.071	2.334E-4	2115	0.128	0.065	Q14980.pdb.gz	NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2
5	AFDB:Q6P9F0	0.141	0.212	6.204E-4	684	0.123	0.194	Q6P9F0.pdb.gz	CCD62_HUMAN Coiled-coil domain-containing protein 62 OS=Homo sapiens OX=9606 GN=CCDC62 PE=1 SV=2
6	AFDB:Q9CS72	0.135	0.122	8.594E-4	1211	0.111	0.099	Q9CS72.pdb.gz	FLIP1_MOUSE Filamin-A-interacting protein 1 OS=Mus musculus OX=10090 GN=Filip1 PE=1 SV=3
7	AFDB:Q86V48	0.089	0.089	4.756E-3	1076	0.159	0.160	Q86V48.pdb.gz	LUZP1_HUMAN Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 PE=1 SV=2
8	AFDB:Q00083	0.099	0.070	1.488E-2	1676	0.146	0.094	Q00083.pdb.gz	APSA_EMENI Anucleate primary sterigmata protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=apsA PE=1 SV=2
9	AFDB:P12036	0.125	0.131	1.752E-2	1026	0.136	0.143	P12036.pdb.gz	NFH_HUMAN Neurofilament heavy polypeptide OS=Homo sapiens OX=9606 GN=NEFH PE=1 SV=4
10	AFDB:Q5PR69	0.062	0.056	2.633E-2	1207	0.114	0.102	Q5PR69.pdb.gz	CRACD_MOUSE Capping protein-inhibiting regulator of actin dynamics OS=Mus musculus OX=10090 GN=Cracd PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15149	0.062	40.0	4684	0.060	0.014	PLEC_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3
2	Q9W1B0	0.29	37.7	1637	0.059	0.039	GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster OX=7227 GN=gek PE=1 SV=1
3	Q9JI55	0.47	37.4	4473	0.062	0.015	PLEC_CRIGR Plectin (Fragment) OS=Cricetulus griseus OX=10029 GN=PLEC PE=1 SV=1
4	Q921M4	0.93	36.2	999	0.035	0.038	GOGA2_MOUSE Golgin subfamily A member 2 OS=Mus musculus OX=10090 GN=Golga2 PE=1 SV=3
5	Q9QXS1	1.2	35.8	4691	0.044	0.010	PLEC_MOUSE Plectin OS=Mus musculus OX=10090 GN=Plec PE=1 SV=3
6	Q8TDY2	2.1	35.0	1594	0.104	0.070	RBCC1_HUMAN RB1-inducible coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=RB1CC1 PE=1 SV=3
7	P30427	3.2	34.3	4687	0.057	0.013	PLEC_RAT Plectin OS=Rattus norvegicus OX=10116 GN=Plec PE=1 SV=2
8	Q7TT50	3.3	34.3	1713	0.032	0.020	MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus OX=10090 GN=Cdc42bpb PE=1 SV=2
9	Q9UTJ8	3.8	33.9	1285	0.034	0.029	RAD50_SCHPO DNA repair protein rad50 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad50 PE=1 SV=3
10	Q95PX7	4.1	33.9	914	0.048	0.057	Q95PX7_CAEEL WW domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tcer-1 PE=1 SV=1
11	Q54XP9	5.3	33.5	1297	0.023	0.019	Q54XP9_DICDI Centrosomal protein 148 kDa OS=Dictyostelium discoideum OX=44689 GN=DDB_G0278809 PE=4 SV=1
12	A0A2R8QCI3	7.3	33.1	2023	0.064	0.034	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1
13	Q9NQX4	7.5	33.1	1742	0.083	0.052	MYO5C_HUMAN Unconventional myosin-Vc OS=Homo sapiens OX=9606 GN=MYO5C PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15818 CCDC73	0	1866.7	Coiled-coil domain-containing protein 73 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335325

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328923	0.773	KN motif and ankyrin repeat domain-containing protein 3
2	9606.ENSP00000469441	0.769	Cancer/testis antigen 1A
3	9606.ENSP00000332602	0.768	Cancer/testis antigen 1B
4	9606.ENSP00000360381	0.676	CUB domain containing protein 2
5	9606.ENSP00000335595	0.651	T-complex protein 11-like protein 1
6	9606.ENSP00000445247	0.648	Proline-rich protein 19
7	9606.ENSP00000362894	0.644	Rhotekin-2
8	9606.ENSP00000444278	0.632	Transmembrane gamma-carboxyglutamic acid protein 1
9	9606.ENSP00000396441	0.630	G-patch domain containing 4
10	9606.ENSP00000405252	0.630	A-kinase anchor protein 7 isoform gamma
11	9606.ENSP00000333003	0.624	Serine protease 55
12	9606.ENSP00000436049	0.610	Eukaryotic translation initiation factor 3 subunit M
13	9606.ENSP00000382241	0.608	Glutamine and serine rich 1
14	9606.ENSP00000420610	0.606	Uncharacterized protein C6orf201
15	9606.ENSP00000312458	0.599	Protein ARV1
16	9606.ENSP00000482767	0.591	La-related protein 4B
17	9606.ENSP00000419599	0.587	DPH3 homolog
18	9606.ENSP00000232978	0.578	NK-tumor recognition protein
19	9606.ENSP00000362942	0.569	Phosphatase and actin regulator 4
20	9606.ENSP00000257836	0.565	Transmembrane gamma-carboxyglutamic acid protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0065007	0.987	biological regulation
GO:0050789	0.983	regulation of biological process
GO:0050794	0.949	regulation of cellular process
GO:0007049	0.577	cell cycle
GO:0008152	0.535	metabolic process
GO:0071840	0.522	cellular component organization or biogenesis
GO:0071704	0.504	organic substance metabolic process
GO:0044238	0.495	primary metabolic process
GO:0016043	0.484	cellular component organization
GO:0044237	0.472	cellular metabolic process
GO:0006807	0.426	nitrogen compound metabolic process
GO:0019222	0.404	regulation of metabolic process
GO:0080090	0.377	regulation of primary metabolic process
GO:0043170	0.366	macromolecule metabolic process
GO:0060255	0.304	regulation of macromolecule metabolic process
GO:0048518	0.302	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0043227	0.998	membrane-bounded organelle
GO:0005634	0.988	nucleus
GO:0043233	0.971	organelle lumen
GO:0005737	0.966	cytoplasm
GO:0070013	0.948	intracellular organelle lumen
GO:0032991	0.942	protein-containing complex
GO:0031981	0.902	nuclear lumen
GO:0043232	0.868	intracellular non-membrane-bounded organelle
GO:0016020	0.655	membrane
GO:0005654	0.481	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]