StarFunc result for job id Q6ZRQ5

User Input

>input (1243 residues)
MENCSAASTFLTDSLELELGTEWCKPPYFSCAVDNRGGGKHFSGESYLCSGALKRLILNL
DPLPTNFEEDTLEIFGIQWVTETALVNSSRELFHLFRQQLYNLETLLQSSCDFGKVSTLH
CKADNIRQQCVLFLHYVKVFIFRYLKVQNAESHVPVHPYEALEAQLPSVLIDELHGLLLY
IGHLSELPSVNIGAFVNQNQIKLFPPSWHLLHLHLDIHWLVLEILYMLGEKLKQVVYGHQ
FMNLASDNLTNISLFEEHCETLLCDLISLSLNRYDKVRSSESLMSDQCPCLCIKELWVLL
IHLLDHRSKWFVSESFWNWLNKLLKTLLEKSSDRRRSSMPVIQSRDPLGFSWWIITHVAS
FYKFDRHGVPDEMRKVESNWNFVEELLKKSISVQGVILEEQLRMYLHCCLTLCDFWEPNI
AIVTILWEYYSKNLNSSFSISWLPFKGLANTMKSPLSMLEMVKTCCCDKQDQELYKSSSS
YTIFLCILAKVVKKAMKSNGPHPWKQVKGRIYSKFHQKRMEELTEVGLQNFFSLFLLLAA
VAEVEDVASHVLDLLNFLKPAFVTSQRALIWKGHMAFLLMYAQKNLDIGVLAEKFSCAFR
EKAKEFLVSKNEEMVQRQTIWTLLSIYIDGVQEVFETSYCLYPSHEKLLNDGFSMLLRAC
RESELRTVLSFLQAVLARIRSMHQQLCQELQRDNVDLFVQSSLSAKERHLAAVASALWRH
FFSFLKSQRMSQVVPFSQLADAAADFTLLAMDMPSTAPSDFQPQPVISIIQLFGWDDIIC
PQVVARYLSHVLQNSTLCEALSHSGYVSFQALTVRSWIRCVLQMYIKNLSGPDDLLIDKN
LEEAVEKEYMKQLVKLTRLLFNLSEVKSIFSKAQVEYLSISEDPKKALVRFFEAVGVTYG
NVQTLSDKSAMVTKSLEYLGEVLKYIKPYLGKKVFSAGLQLTYGMMGILVKSWAQIFATS
KAQKLLFRIIDCLLLPHAVLQQEKELPAPMLSAIQKSLPLYLQGMCIVCCQSQNPNAYLN
QLLGNVIEQYIGRFLPASPYVSDLGQHPVLLALRNTATIPPISSLKKCIVQVIRKSYLEY
KGSSPPPRLASILAFILQLFKETNTDIYEVELLLPGILKCLVLVSEPQVKRLATENLQYM
VKACQVGSEEEPSSQLTSVFRQFIQDYGMRYYYQVYSILETVATLDQQVVIHLISTLTQS
LKDSEQKWGLGRNIAQREAYSKLLSHLGQMGQDEMQRLENDNT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E2QRD4	0.664	0.682	0.000	1203	0.967	0.999	E2QRD4.pdb.gz	E2QRD4_HUMAN Protein MMS22-like OS=Homo sapiens OX=9606 GN=MMS22L PE=1 SV=1
2	AFDB:Q6ZRQ5	1.000	1.000	0.000	1243	1.000	1.000	Q6ZRQ5.pdb.gz	MMS22_HUMAN Protein MMS22-like OS=Homo sapiens OX=9606 GN=MMS22L PE=1 SV=3
3	AFDB:Q9D071	0.226	0.261	3.047E-7	1031	0.114	0.138	Q9D071.pdb.gz	MMS19_MOUSE MMS19 nucleotide excision repair protein homolog OS=Mus musculus OX=10090 GN=Mms19 PE=1 SV=1
4	AFDB:O75155	0.137	0.137	7.552E-7	1236	0.109	0.110	O75155.pdb.gz	CAND2_HUMAN Cullin-associated NEDD8-dissociated protein 2 OS=Homo sapiens OX=9606 GN=CAND2 PE=1 SV=3
5	AFDB:Q8L5Y6	0.153	0.154	9.643E-7	1219	0.126	0.129	Q8L5Y6.pdb.gz	CAND1_ARATH Cullin-associated NEDD8-dissociated protein 1 OS=Arabidopsis thaliana OX=3702 GN=CAND1 PE=1 SV=1
6	PDB:7mqaLM	0.164	0.122	1.045E-6	2041	0.124	0.075	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
7	AFDB:O60518	0.142	0.156	1.872E-6	1105	0.114	0.129	O60518.pdb.gz	RNBP6_HUMAN Ran-binding protein 6 OS=Homo sapiens OX=9606 GN=RANBP6 PE=1 SV=2
8	AFDB:Q9VKY2	0.132	0.132	2.007E-6	1248	0.124	0.123	Q9VKY2.pdb.gz	CAND1_DROME Cullin-associated NEDD8-dissociated protein 1 OS=Drosophila melanogaster OX=7227 GN=Cand1 PE=2 SV=1
9	AFDB:Q583M5	0.090	0.075	2.475E-6	1621	0.126	0.097	Q583M5.pdb.gz	Q583M5_TRYB2 TOG domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.840 PE=3 SV=1
10	AFDB:Q9R0L4	0.141	0.139	2.947E-6	1273	0.127	0.124	Q9R0L4.pdb.gz	CAND2_RAT Cullin-associated NEDD8-dissociated protein 2 OS=Rattus norvegicus OX=10116 GN=Cand2 PE=1 SV=1
11	PDB:5hb4B	0.172	0.160	3.083E-6	1388	0.118	0.106	5hb4B.pdb.gz
12	AFDB:Q6DFV1	0.127	0.136	3.272E-6	1138	0.121	0.132	Q6DFV1.pdb.gz	CNDG2_MOUSE Condensin-2 complex subunit G2 OS=Mus musculus OX=10090 GN=Ncapg2 PE=1 SV=2
13	PDB:7mq8LM	0.138	0.098	6.418E-6	2005	0.131	0.081	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:6tc0C	0.265	0.318	9.758E-6	994	0.112	0.140	6tc0C.pdb.gz
15	PDB:7ua3A	0.128	0.061	1.203E-5	4443	0.134	0.037	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
16	PDB:7mqaSP	0.200	0.123	1.290E-5	2485	0.130	0.065	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7sukSP	0.136	0.096	2.178E-5	2234	0.124	0.069	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
18	PDB:7jq9A	0.167	0.113	2.336E-5	2427	0.120	0.061	7jq9A.pdb.gz
19	PDB:7zf1B	0.123	0.127	2.593E-5	1179	0.114	0.120	7zf1B.pdb.gz
20	PDB:7tyrA	0.181	0.094	2.686E-5	3905	0.146	0.046	7tyrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E2QRD4	0.0	2455	1203	0.968	1.000	E2QRD4_HUMAN Protein MMS22-like OS=Homo sapiens OX=9606 GN=MMS22L PE=1 SV=1
2	Q6ZRQ5	0.0	2560	1243	1.000	1.000	MMS22_HUMAN Protein MMS22-like OS=Homo sapiens OX=9606 GN=MMS22L PE=1 SV=3
3	Q9NU22	0.29	38.1	5596	0.027	0.006	MDN1_HUMAN Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2
4	Q9S7N7	3.2	33.1	160	0.011	0.087	PSAG_ARATH Photosystem I reaction center subunit V, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PSAG PE=1 SV=1
5	Q9H0D2	3.9	34.3	1346	0.016	0.015	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10557 Cullin_Nedd8	3.4e+02	12.7	Cullin protein neddylation domain
2	PF14911 MMS22L_C	5e-138	471.9	S-phase genomic integrity recombination mediator, C-terminal
3	PF14910 MMS22L_N	0	1252.0	S-phase genomic integrity recombination mediator, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000275053

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386239	0.998	Tonsoku-like protein
2	9606.ENSP00000263382	0.870	Histone chaperone ASF1B
3	9606.ENSP00000229595	0.775	Histone chaperone ASF1A
4	9606.ENSP00000372088	0.769	DNA repair protein RAD51 homolog 1
5	9606.ENSP00000307288	0.765	DNA replication licensing factor MCM7
6	9606.ENSP00000322180	0.741	Sister chromatid cohesion protein DCC1
7	9606.ENSP00000352252	0.739	Histone cluster 1 H3 family member j
8	9606.ENSP00000374328	0.726	Failed axon connections homolog
9	9606.ENSP00000278412	0.700	FACT complex subunit SSRP1
10	9606.ENSP00000451974	0.692	DNA repair protein XRCC3
11	9606.ENSP00000369857	0.687	BRCA1-A complex subunit Abraxas 1
12	9606.ENSP00000369176	0.676	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
13	9606.ENSP00000418960	0.664	Breast cancer type 1 susceptibility protein
14	9606.ENSP00000264156	0.658	DNA replication licensing factor MCM6
15	9606.ENSP00000264159	0.645	DNA annealing helicase and endonuclease ZRANB3
16	9606.ENSP00000265056	0.642	DNA replication licensing factor MCM2
17	9606.ENSP00000377601	0.601	Lymphoid-specific helicase
18	9606.ENSP00000319713	0.594	Type-1 angiotensin II receptor-associated protein
19	9606.ENSP00000312995	0.585	Claspin
20	9606.ENSP00000216122	0.583	DNA replication licensing factor MCM5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003697	1.000	single-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0006261	0.982	DNA-templated DNA replication
GO:0006302	0.980	double-strand break repair
GO:0006310	0.949	DNA recombination
GO:0000725	0.943	recombinational repair
GO:0031297	0.896	replication fork processing
GO:0000724	0.891	double-strand break repair via homologous recombination
GO:0050789	0.657	regulation of biological process
GO:0050794	0.493	regulation of cellular process
GO:0071840	0.399	cellular component organization or biogenesis
GO:0016043	0.393	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0032991	0.984	protein-containing complex
GO:0043228	0.982	non-membrane-bounded organelle
GO:0043232	0.973	intracellular non-membrane-bounded organelle
GO:0005694	0.927	chromosome
GO:0000785	0.573	chromatin
GO:0000228	0.566	nuclear chromosome
GO:0140513	0.530	nuclear protein-containing complex
GO:0005657	0.416	replication fork
GO:0090734	0.390	site of DNA damage
GO:0043596	0.369	nuclear replication fork

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]