StarFunc result for job id Q6ZRR7

User Input

>input (1453 residues)
MIESENLNQEEIIKELCLCNGLSYEMVGQEGSDTSKLEMFFLGYPRIVGLSLFPNLTSLT
IVAQDIKEISGLEPCLQLKELWIAECCIEKIEGLQECRNLEKLYLYFNKISKIENLEKLI
KLKVLWLNHNTIKNIEGLQTLKNLKDLNLAGNLINSIGRCLDSNEQLERLNLSGNQICSF
KELTNLTRLPCLKDLCLNDPQYTTNPVCLLCNYSTHVLYHLPCLQRFDTLDVSAKQIKEL
ADTTAMKKIMYYNMRIKTLQRHLKEDLEKLNDQKCKLQKLPEERVKLFSFVKKTLERELA
ELKGSGKGHSDGSNNSKVTDPETLKSCETVTEEPSLQQKILAKLNALNERVTFWNKKLDE
IEAIYHIEVKQKKKSHGLLIPLLLIELETVGNFHFEEGTRSDDWFNFCYELILSRFCAWD
FRTYGITGVKVKRIIKVNNRILRLKFEEKFQKFLENEDMHDSESYRRMLECLFYVFDPEV
SVKKKHLLQILEKGFKDSETSKLPLKKEAIIVSNSLSISECPRIEFLQQKHKDEKKISLK
HELFRHGILLITKVFLGQSVQAHEKESISQSNYPMVNSVFIPRKYLLNSVMGQRNCDCSV
RQCKWFVFDHDLVLPEYVVEFEYITMVKAPSLFSVFNNVILEESKKNPEVSVFSKDLKFD
DEVIKMEPRIKARPKLISLDDKTILSLAKTSVYSHIVSLNLHGNSLSKLRDLSKLTGLRK
LNISFNEFTCLDDVYHLYNLEYLDASHNHVITLEGFRGLMKLKHLDLSWNQLKKSGNEIN
MLCKHTTSLLTLDIQHNPWQKPATLRLSVIGRLKTLTHLNGVFISEEEATAAMKFIAGTR
ITQLSLLRHSSTKEERPRILSIWPSAKILTQVSKLGPHLHLSGNCYLKITALNLDGQHLF
EITNLEKLENLKWASFSNNNLTKMEGLESCINLEELTLDGNCISKIEGISKMTKLTRLSI
NNNLLTGWEEHTFDNMLHLHSLSLENNRITSLSGLQKSFTLVELYISNNYIAVNQEMHNL
KGLCNLVILDMCGNIIIWNQENYRLFVIFHLPELKALDGIPIEPSETDSAKDLFGGRLTS
DMIAERQGHSNFKQMQELNWTSSSIRTVDLIPVDQFRNVCNVNLQNNHLTSFSGLIYLPN
VKVLCLNYNHIESIMPRLKPQTHLTSRQLLYQKVPSSGYGQQGISKTNRDIMSSENLPPI
MHSLEVLHLGYNGICNLIQLQLNRLRNLKFLFLQGNEISQVEGLDNLVVLQELVVDHNRI
RSFNDSAFAKPSSLLALHLEENRLRELGKLQSLVKLEKLFLGYNKIQDITELEKLDVIST
LRELTVYGNPICRKMLHRHMLIFRLPNLQMLDGSPVNSDDRAKAEFHLAELQAKKNSLIP
VTHSPMDGRSFGQVKTPPIEITNVLLPSGFSHYLGSDVTLTPEVEEFLGATFQDQIECNC
LKRNEHTPRNSPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZRR7	1.000	1.000	0.000	1453	1.000	1.000	Q6ZRR7.pdb.gz	LRRC9_HUMAN Leucine-rich repeat-containing protein 9 OS=Homo sapiens OX=9606 GN=LRRC9 PE=2 SV=2
2	AFDB:Q385P9	0.607	0.592	1.268E-73	1498	0.254	0.246	Q385P9.pdb.gz	Q385P9_TRYB2 Protein phosphatase 1 regulatory subunit 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2850 PE=3 SV=1
3	PDB:7tvfD	0.114	0.282	3.915E-14	515	0.082	0.231	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
4	AFDB:Q8KC98	0.105	0.138	4.219E-14	1102	0.065	0.085	Q8KC98.pdb.gz	Q8KC98_CHLTE Rab family protein OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=CT1526 PE=1 SV=1
5	AFDB:Q9U3W5	0.099	0.424	6.225E-14	326	0.061	0.273	Q9U3W5.pdb.gz	Q9U3W5_DROME Putative mitotic protein phosphatase 1 regulator OS=Drosophila melanogaster OX=7227 GN=sds22 PE=2 SV=1
6	AFDB:P0DJM0	0.117	0.206	5.642E-13	800	0.074	0.134	P0DJM0.pdb.gz	INLA_LISMO Internalin A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=inlA PE=1 SV=1
7	AFDB:Q3UM45	0.108	0.414	7.003E-13	361	0.056	0.227	Q3UM45.pdb.gz	PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus OX=10090 GN=Ppp1r7 PE=1 SV=2
8	AFDB:P45969	0.116	0.508	8.324E-13	326	0.054	0.239	P45969.pdb.gz	SDS22_CAEEL Protein phosphatase 1 regulatory subunit SDS22 homolog OS=Caenorhabditis elegans OX=6239 GN=sds-22 PE=3 SV=1
9	AFDB:C6S3E1	0.103	0.435	2.063E-12	309	0.058	0.272	C6S3E1.pdb.gz	C6S3E1_PLAF7 Protein phosphatase 1 regulatory subunit 7 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1032800 PE=3 SV=1
10	AFDB:Q8IUZ0	0.114	0.225	3.044E-12	686	0.083	0.175	Q8IUZ0.pdb.gz	LRC49_HUMAN Leucine-rich repeat-containing protein 49 OS=Homo sapiens OX=9606 GN=LRRC49 PE=1 SV=2
11	PDB:6hkwA	0.101	0.438	3.662E-12	306	0.058	0.278	6hkwA.pdb.gz
12	AFDB:Q91YK0	0.129	0.263	6.079E-12	686	0.078	0.165	Q91YK0.pdb.gz	LRC49_MOUSE Leucine-rich repeat-containing protein 49 OS=Mus musculus OX=10090 GN=Lrrc49 PE=1 SV=1
13	PDB:3b2dA	0.118	0.246	5.510E-10	601	0.084	0.203	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
14	PDB:7wv3A	0.107	0.209	5.510E-10	668	0.079	0.172	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
15	PDB:3t6qA	0.122	0.273	2.104E-9	601	0.072	0.175	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:6gffI	0.101	0.241	2.695E-8	551	0.080	0.211	6gffI.pdb.gz
17	PDB:7p5vB	0.134	0.253	2.938E-8	732	0.061	0.120	7p5vB.pdb.gz
18	PDB:2ft3F	0.079	0.329	4.284E-7	305	0.043	0.203	2ft3F.pdb.gz
19	PDB:1m9sA	0.112	0.300	2.214E-6	523	0.032	0.090	1m9sA.pdb.gz
20	PDB:6x0lP	0.116	0.323	4.819E-6	474	0.028	0.086	6x0lP.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZRR7	0.0	2962	1453	1.000	1.000	LRRC9_HUMAN Leucine-rich repeat-containing protein 9 OS=Homo sapiens OX=9606 GN=LRRC9 PE=2 SV=2
2	Q385P9	5.16e-59	226	1498	0.120	0.117	Q385P9_TRYB2 Protein phosphatase 1 regulatory subunit 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2850 PE=3 SV=1
3	A2AL36	4.46e-16	87.0	2334	0.046	0.029	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
4	Q7Z7A1	4.89e-16	87.0	2325	0.047	0.029	CNTRL_HUMAN Centriolin OS=Homo sapiens OX=9606 GN=CNTRL PE=1 SV=2
5	P45969	4.62e-14	77.4	326	0.043	0.193	SDS22_CAEEL Protein phosphatase 1 regulatory subunit SDS22 homolog OS=Caenorhabditis elegans OX=6239 GN=sds-22 PE=3 SV=1
6	Q9D5E4	6.95e-14	78.6	523	0.047	0.130	DRC3_MOUSE Dynein regulatory complex subunit 3 OS=Mus musculus OX=10090 GN=Drc3 PE=1 SV=1
7	Q91YK0	1.36e-13	78.2	686	0.043	0.090	LRC49_MOUSE Leucine-rich repeat-containing protein 49 OS=Mus musculus OX=10090 GN=Lrrc49 PE=1 SV=1
8	Q5AHH6	1.51e-13	76.6	374	0.036	0.139	Q5AHH6_CANAL Type 1 protein phosphatase-activating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SDS22 PE=4 SV=1
9	Q3UM45	3.93e-13	75.1	361	0.048	0.194	PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus OX=10090 GN=Ppp1r7 PE=1 SV=2
10	Q8IUZ0	4.13e-13	76.6	686	0.043	0.092	LRC49_HUMAN Leucine-rich repeat-containing protein 49 OS=Homo sapiens OX=9606 GN=LRRC49 PE=1 SV=2
11	Q15435	6.07e-13	74.3	360	0.049	0.197	PP1R7_HUMAN Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7 PE=1 SV=1
12	Q96M69	1.15e-11	72.0	825	0.045	0.080	LRGUK_HUMAN Leucine-rich repeat and guanylate kinase domain-containing protein OS=Homo sapiens OX=9606 GN=LRGUK PE=1 SV=1
13	C6S3E1	1.39e-11	69.7	309	0.050	0.233	C6S3E1_PLAF7 Protein phosphatase 1 regulatory subunit 7 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1032800 PE=3 SV=1
14	P0DJM0	1.98e-11	71.2	800	0.064	0.116	INLA_LISMO Internalin A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=inlA PE=1 SV=1
15	Q9XHH2	2.77e-11	66.6	198	0.039	0.288	DNAL1_CHLRE Dynein axonemal light chain 1 OS=Chlamydomonas reinhardtii OX=3055 GN=LC1 PE=1 SV=1
16	Q84WJ9	3.89e-11	68.6	328	0.031	0.137	PP1R7_ARATH Protein phosphatase 1 regulatory inhibitor subunit PPP1R7 homolog OS=Arabidopsis thaliana OX=3702 GN=At5g19680 PE=1 SV=1
17	Q9VEK8	4.87e-11	68.2	326	0.045	0.202	Q9VEK8_DROME GH07711p OS=Drosophila melanogaster OX=7227 GN=sds22 PE=1 SV=1
18	P22194	5.05e-11	68.2	332	0.046	0.202	SDS22_SCHPO Protein phosphatase 1 regulatory subunit SDS22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sds22 PE=1 SV=2
19	Q9D5S7	5.93e-11	69.7	820	0.041	0.073	LRGUK_MOUSE Leucine-rich repeat and guanylate kinase domain-containing protein OS=Mus musculus OX=10090 GN=Lrguk PE=1 SV=1
20	Q8KC98	6.10e-11	70.1	1102	0.066	0.087	Q8KC98_CHLTE Rab family protein OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=CT1526 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12799 LRR_4	2.2e-44	159.8	Leucine Rich repeats (2 copies)
2	PF13516 LRR_6	7.5e+02	11.7	Leucine Rich repeat
3	PF13855 LRR_8	4.4e-32	120.9	Leucine rich repeat
4	PF14580 LRR_9	3.7e-32	122.8	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000454748

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368477	0.786	Stress-associated endoplasmic reticulum protein 2
2	9606.ENSP00000314173	0.753	Sterile alpha motif domain containing 12
3	9606.ENSP00000467466	0.730	Ribosomal protein S15
4	9606.ENSP00000377668	0.727	Sulfite oxidase, mitochondrial
5	9606.ENSP00000348459	0.724	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase
6	9606.ENSP00000258145	0.712	N-acetylglucosamine-6-sulfatase
7	9606.ENSP00000464162	0.697	GREB1-like protein
8	9606.ENSP00000046794	0.674	Lymphocyte cytosolic protein 2
9	9606.ENSP00000230050	0.660	Ribosomal protein S12
10	9606.ENSP00000368994	0.658	Rho GTPase-activating protein 44
11	9606.ENSP00000361932	0.595	Alpha-(1,3)-fucosyltransferase 11
12	9606.ENSP00000482523	0.595	CMT1A duplicated region transcript 4
13	9606.ENSP00000220822	0.585	Ganglioside-induced differentiation-associated protein 1
14	9606.ENSP00000381436	0.552	Transcription cofactor vestigial-like protein 3
15	9606.ENSP00000305725	0.524	Carbohydrate sulfotransferase 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.395	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0008152	0.741	metabolic process
GO:0071704	0.622	organic substance metabolic process
GO:0044238	0.579	primary metabolic process
GO:0006807	0.543	nitrogen compound metabolic process
GO:0043170	0.444	macromolecule metabolic process
GO:1901564	0.314	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.948	organelle
GO:0043229	0.939	intracellular organelle
GO:0005829	0.906	cytosol
GO:0043231	0.825	intracellular membrane-bounded organelle
GO:0016020	0.763	membrane
GO:0070013	0.629	intracellular organelle lumen
GO:0043232	0.617	intracellular non-membrane-bounded organelle
GO:0005634	0.415	nucleus
GO:0031981	0.370	nuclear lumen
GO:0005654	0.339	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]