StarFunc result for job id Q6ZRS2

User Input

>input (1400 residues)
MQSSPSPAHPQLPVLQTQMVSDGMTGSNPVSPASSSSPASSGAGGISPQHIAQDSSLDGP
PGPPDGATVPLEGFSLSQAADLANKGPKWEKSHAEIAEQAKHEAEIETRIAELRKEGFWS
LKRLPKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKE
ERARREEQAKLRRIASTMAKDVRQFWSNVEKVVQFKQQSRLEEKRKKALDLHLDFIVGQT
EKYSDLLSQSLNQPLTSSKAGSSPCLGSSSAASSPPPPASRLDDEDGDFQPQEDEEEDDE
ETIEVEEQQEGNDAEAQRREIELLRREGELPLEELLRSLPPQLLEGPSSPSQTPSSHDSD
TRDGPEEGAEEEPPQVLEIKPPPSAVTQRNKQPWHPDEDDEEFTANEEEAEDEEDTIAAE
EQLEGEVDHAMELSELAREGELSMEELLQQYAGAYAPGSGSSEDEDEDEVDANSSDCEPE
GPVEAEEPPQEDSSSQSDSVEDRSEDEEDEHSEEEETSGSSASEESESEESEDAQSQSQA
DEEEEDDDFGVEYLLARDEEQSEADAGSGPPTPGPTTLGPKKEITDIAAAAESLQPKGYT
LATTQVKTPIPLLLRGQLREYQHIGLDWLVTMYEKKLNGILADEMGLGKTIQTISLLAHL
ACEKGNWGPHLIIVPTSVMLNWEMELKRWCPSFKILTYYGAQKERKLKRQGWTKPNAFHV
CITSYKLVLQDHQAFRRKNWRYLILDEAQNIKNFKSQRWQSLLNFNSQRRLLLTGTPLQN
SLMELWSLMHFLMPHVFQSHREFKEWFSNPLTGMIEGSQEYNEGLVKRLHKVLRPFLLRR
VKVDVEKQMPKKYEHVIRCRLSKRQRCLYDDFMAQTTTKETLATGHFMSVINILMQLRKV
CNHPNLFDPRPVTSPFITPGICFSTASLVLRATDVHPLQRIDMGRFDLIGLEGRVSRYEA
DTFLPRHRLSRRVLLEVATAPDPPPRPKPVKMKVNRMLQPVPKQEGRTVVVVNNPRAPLG
PVPVRPPPGPELSAQPTPGPVPQVLPASLMVSASPAGPPLIPASRPPGPVLLPPLQPNSG
SLPQVLPSPLGVLSGTSRPPTPTLSLKPTPPAPVRLSPAPPPGSSSLLKPLTVPPGYTFP
PAAATTTSTTTATATTTAVPAPTPAPQRLILSPDMQARLPSGEVVSIGQLASLAQRPVAN
AGGSKPLTFQIQGNKLTLTGAQVRQLAVGQPRPLQRNVVHLVSAGGQHHLISQPAHVALI
QAVAPTPGPTPVSVLPSSTPSTTPAPTGLSLPLAANQVPPTMVNNTGVVKIVVRQAPRDG
LTPVPPLAPAPRPPSSGLPAVLNPRPTLTPGRLPTPTLGTARAPMPTPTLVRPLLKLVHS
PSPEVSASAPGAAPLTISSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6gejM	0.210	0.414	6.897E-36	688	0.151	0.307	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
2	AFDB:F4JY25	0.208	0.269	3.939E-33	1072	0.098	0.128	F4JY25.pdb.gz	F4JY25_ARATH Chromatin remodeling factor17 OS=Arabidopsis thaliana OX=3702 GN=CHR17 PE=1 SV=1
3	AFDB:Q24368	0.200	0.269	5.018E-33	1027	0.102	0.139	Q24368.pdb.gz	ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster OX=7227 GN=Iswi PE=1 SV=1
4	AFDB:B7ZLQ5	0.202	0.261	2.729E-32	1070	0.104	0.136	B7ZLQ5.pdb.gz	B7ZLQ5_HUMAN SMARCA1 protein OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=1
5	AFDB:P41877	0.207	0.283	1.890E-31	1009	0.107	0.149	P41877.pdb.gz	ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans OX=6239 GN=isw-1 PE=1 SV=2
6	AFDB:A5WUY4	0.199	0.265	2.266E-31	1036	0.102	0.138	A5WUY4.pdb.gz	A5WUY4_DANRE Probable global transcription activator SNF2L1 OS=Danio rerio OX=7955 GN=si:dkey-148b12.1 PE=1 SV=1
7	AFDB:P38144	0.201	0.247	9.677E-31	1129	0.096	0.119	P38144.pdb.gz	ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW1 PE=1 SV=2
8	AFDB:Q5A310	0.198	0.259	5.263E-30	1056	0.097	0.129	Q5A310.pdb.gz	ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ISW2 PE=2 SV=1
9	AFDB:Q08773	0.201	0.248	1.385E-29	1120	0.099	0.123	Q08773.pdb.gz	ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW2 PE=1 SV=1
10	AFDB:F4J9M5	0.206	0.259	1.298E-28	1102	0.104	0.132	F4J9M5.pdb.gz	CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana OX=3702 GN=CHR12 PE=2 SV=1
11	AFDB:Q86WJ1	0.206	0.319	1.550E-27	897	0.086	0.134	Q86WJ1.pdb.gz	CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens OX=9606 GN=CHD1L PE=1 SV=3
12	PDB:6jylK	0.204	0.545	1.285E-25	504	0.094	0.262	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
13	PDB:6tdaS	0.197	0.343	8.381E-25	783	0.091	0.162	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
14	PDB:7epuB	0.159	0.293	8.381E-25	748	0.081	0.152	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
15	PDB:6g0lM	0.177	0.287	2.479E-23	855	0.078	0.127	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
16	PDB:6g0lW	0.182	0.285	3.354E-23	878	0.084	0.133	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
17	PDB:7oo3b	0.194	0.481	4.272E-23	534	0.079	0.208	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
18	PDB:6uxwA	0.204	0.358	5.442E-23	778	0.094	0.170	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
19	PDB:6kw3Y	0.201	0.489	3.130E-21	548	0.093	0.237	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
20	PDB:5vvrM	0.188	0.485	4.164E-17	503	0.073	0.203	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZRS2	0.0	2834	3230	1.000	0.433	SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens OX=9606 GN=SRCAP PE=1 SV=3
2	Q7X9V2	0.0	663	2055	0.304	0.207	PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana OX=3702 GN=PIE1 PE=1 SV=1
3	Q9NDJ2	0.0	867	3198	0.320	0.140	DOM_DROME Helicase domino OS=Drosophila melanogaster OX=7227 GN=dom PE=1 SV=2
4	Q9NEL2	6.15e-175	578	2395	0.203	0.119	SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans OX=6239 GN=ssl-1 PE=2 SV=4
5	A0A0G2JU09	3.95e-154	520	3152	0.216	0.096	A0A0G2JU09_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
6	A0A8I6G935	5.42e-153	517	3146	0.216	0.096	A0A8I6G935_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
7	O13682	7.25e-147	483	1288	0.165	0.179	SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swr1 PE=3 SV=1
8	Q05471	9.99e-144	479	1514	0.155	0.143	SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWR1 PE=1 SV=1
9	Q8CHI8	5.07e-139	475	3072	0.171	0.078	EP400_MOUSE E1A-binding protein p400 OS=Mus musculus OX=10090 GN=Ep400 PE=1 SV=3
10	D3ZQ89	3.39e-137	470	3034	0.156	0.072	D3ZQ89_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
11	A0A8I5ZTE5	4.27e-137	469	2998	0.156	0.073	A0A8I5ZTE5_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
12	Q96L91	1.39e-130	450	3159	0.155	0.069	EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens OX=9606 GN=EP400 PE=1 SV=4
13	Q383K6	1.39e-110	380	1211	0.119	0.138	Q383K6_TRYB2 SNF2 DNA repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2500 PE=4 SV=1
14	O14148	1.13e-91	330	1604	0.106	0.093	INO80_SCHPO Chromatin-remodeling ATPase INO80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ino80 PE=1 SV=4
15	Q9ULG1	2.47e-90	325	1556	0.109	0.098	INO80_HUMAN Chromatin-remodeling ATPase INO80 OS=Homo sapiens OX=9606 GN=INO80 PE=1 SV=2
16	Q6ZPV2	2.82e-90	325	1559	0.109	0.097	INO80_MOUSE Chromatin-remodeling ATPase INO80 OS=Mus musculus OX=10090 GN=Ino80 PE=1 SV=2
17	Q9VDY1	6.33e-90	324	1638	0.108	0.092	INO80_DROME Chromatin-remodeling ATPase INO80 OS=Drosophila melanogaster OX=7227 GN=Ino80 PE=1 SV=2
18	F4J277	4.19e-88	318	1540	0.127	0.116	F4J277_ARATH Chromatin-remodeling ATPase INO80 OS=Arabidopsis thaliana OX=3702 GN=INO80 PE=1 SV=1
19	P53115	6.72e-88	317	1489	0.107	0.101	INO80_YEAST Chromatin-remodeling ATPase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INO80 PE=1 SV=1
20	A5WUY4	4.83e-77	280	1036	0.100	0.135	A5WUY4_DANRE Probable global transcription activator SNF2L1 OS=Danio rerio OX=7955 GN=si:dkey-148b12.1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00270 DEAD	0.02	26.2	DEAD/DEAH box helicase
2	PF10735 DUF2526	8.2e+02	11.7	Protein of unknown function (DUF2526)
3	PF07529 HSA	2.2e-16	71.2	HSA domain
4	PF00176 SNF2-rel_dom	1.1e-68	243.2	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262518

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318297	0.999	RuvB-like 1
2	9606.ENSP00000473172	0.999	RuvB-like 2
3	9606.ENSP00000188312	0.998	ARP6 actin related protein 6 homolog
4	9606.ENSP00000340330	0.998	Histone acetyltransferase KAT5
5	9606.ENSP00000361363	0.996	DNA methyltransferase 1-associated protein 1
6	9606.ENSP00000304593	0.993	Zinc finger HIT domain-containing protein 1
7	9606.ENSP00000346464	0.989	Vacuolar protein sorting-associated protein 72 homolog
8	9606.ENSP00000283882	0.985	Craniofacial development protein 1
9	9606.ENSP00000296417	0.977	Histone H2A.Z
10	9606.ENSP00000352925	0.976	Transformation/transcription domain-associated protein
11	9606.ENSP00000247843	0.969	YEATS domain-containing protein 4
12	9606.ENSP00000397552	0.964	Actin-like protein 6A
13	9606.ENSP00000262367	0.959	CREB-binding protein
14	9606.ENSP00000263253	0.941	Histone acetyltransferase p300
15	9606.ENSP00000307208	0.902	Nucleosome-remodeling factor subunit BPTF
16	9606.ENSP00000336842	0.894	Actin-related protein 8
17	9606.ENSP00000301067	0.891	Histone-lysine N-methyltransferase 2D
18	9606.ENSP00000320485	0.891	AT-rich interactive domain-containing protein 1A
19	9606.ENSP00000463154	0.875	Acidic leucine-rich nuclear phosphoprotein 32 family member E
20	9606.ENSP00000373696	0.865	E3 ubiquitin-protein ligase TRIP12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	0.998	catalytic activity
GO:0005515	0.998	protein binding
GO:0016407	0.988	acetyltransferase activity
GO:0140096	0.984	catalytic activity, acting on a protein
GO:0016410	0.827	N-acyltransferase activity
GO:0034212	0.814	peptide N-acetyltransferase activity
GO:0061733	0.791	peptide-lysine-N-acetyltransferase activity
GO:0004402	0.727	histone acetyltransferase activity
GO:0097159	0.646	organic cyclic compound binding
GO:1901363	0.645	heterocyclic compound binding
GO:0003676	0.461	nucleic acid binding
GO:0140657	0.365	ATP-dependent activity
GO:0003677	0.303	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019219	0.986	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.923	regulation of RNA metabolic process
GO:0009889	0.887	regulation of biosynthetic process
GO:0010468	0.849	regulation of gene expression
GO:2001141	0.807	regulation of RNA biosynthetic process
GO:1903506	0.786	regulation of nucleic acid-templated transcription
GO:0006355	0.764	regulation of DNA-templated transcription
GO:0006357	0.590	regulation of transcription by RNA polymerase II
GO:0009987	0.350	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.962	protein-containing complex
GO:0005737	0.938	cytoplasm
GO:0012505	0.807	endomembrane system
GO:0016604	0.807	nuclear body
GO:0005794	0.686	Golgi apparatus
GO:0043232	0.569	intracellular non-membrane-bounded organelle
GO:0048471	0.326	perinuclear region of cytoplasm
GO:0005694	0.320	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	0.988	Transferring groups other than amino-acyl groups.
RHEA:21992	0.727	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	0.727	histone acetyltransferase.

[back to server]