StarFunc result for job id Q6ZRS4

User Input

>input (1044 residues)
MMAQKSQGSDNLQEGQEKSKREILKCTKSAWAPLDEWLPPDPEEESQSLTIPMLEDSKQE
SIQQWLDSGFFVSANENFQQVIDRTVSLYEQGMVQMTVKDYMRSLHQFSETPILSRGTSF
NSCYSTASVPQSIPEWLEFWEIDPVEILLDLGFGADEPDICMQIPARFLGCGSAARGINI
RVFLEAQKQRMDIENPNLYGRFRQLEILDHVTNAFSSLLSDVSILPNRAEEKAGGESVQR
TSVSAAKEHRRRMGKLLRRASKQNIRRDCNPEVSESFKVKDEVFVPFTKPWDCGAELAAT
SINHKQNHLSLSVEHQSLQACDDLLPYPPHGLLSKQWPCSSMPAKQAPPSCVSEGSVKGR
TQKENLFQTNKLKSLSHLAGKGPDSFEMEEVQSFEEETGNPLDMTSGTVGARVDRANSCQ
SDSSGFLEEPLEPLPLQMPSLPNSQSPAENGGRKPRDQSHSLVSSQDCQLESDGPDSKSR
ASMSFSSQEANALEQRASVSVMEEEFLLEAMEGPPELYIPDMACAKTTTRGECPRKDSHL
WQLLPMPHAEYEVTRPTATSKYDHPLGFMVTHVTEMQDSFVRPEGAGKVQSHHNESQRSP
GNDHTQDKFLHVDSEAPREEESSGFCPHTNHSLLVPESSSQCIPKHSEITPYATDLAQTS
EKLIPHLHKLPGDPAQVKSRSGTLGQILPGTEAEMENLPLNTGSSRSVMTQMSSSLVSAA
QRAVALGTGPRGTSLECTVCDPVTATETRLGTKARQLNDASIQTSALSNKTLTHGPQPLT
KSVSLDSGFSSICPMGTCHAIPAHCCICCHHHPHCHGERQSPGPEPSVCRHCLCSLTGHQ
EAQFMTTLKALQDTTVRELCSCTVHEMEAMKTICQSFREYLEEIEQHLMGQQALFSRDMS
EEEREEAEQLQTLREALRQQVAELEFQLGDRAQQIREGILLQLEVLTAEPPEHYSNLHQY
NWIEESNGQTSCSKIHPGMAPRTVFPPDDGQEAPCSGGTQLAAFTPPTLENSTRMSPSSS
AWAKLGPTPLSNCPVGEKDADVFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PHV5	0.087	0.074	1.674E-15	1237	0.204	0.172	E9PHV5.pdb.gz	E9PHV5_HUMAN ITPR interacting domain containing 2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=1
2	AFDB:P28290	0.099	0.083	3.483E-15	1259	0.221	0.183	P28290.pdb.gz	ITPI2_HUMAN Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=3
3	AFDB:Q8IJP9	0.045	0.022	8.028E-5	2578	0.122	0.049	Q8IJP9.pdb.gz	Q8IJP9_PLAF7 Transcriptional coactivator ADA2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1014600 PE=4 SV=1
4	AFDB:Q5JRA6	0.044	0.032	2.892E-4	1907	0.130	0.071	Q5JRA6.pdb.gz	TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1
5	AFDB:P48681	0.049	0.034	9.801E-4	1621	0.144	0.093	P48681.pdb.gz	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
6	AFDB:A6NJU9	0.069	0.066	1.697E-3	1138	0.150	0.138	A6NJU9.pdb.gz	NPB13_HUMAN Nuclear pore complex-interacting protein family member B13 OS=Homo sapiens OX=9606 GN=NPIPB13 PE=3 SV=4
7	AFDB:Q9SZQ2	0.052	0.046	4.790E-3	1211	0.143	0.123	Q9SZQ2.pdb.gz	Q9SZQ2_ARATH AT4g29790/F27B13_30 OS=Arabidopsis thaliana OX=3702 GN=At4g29790 PE=1 SV=1
8	AFDB:F4HWC3	0.042	0.033	7.805E-3	1364	0.133	0.102	F4HWC3.pdb.gz	F4HWC3_ARATH Calponin-like domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g20970 PE=1 SV=1
9	AFDB:F4IZM8	0.057	0.047	9.963E-3	1347	0.149	0.116	F4IZM8.pdb.gz	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
10	AFDB:Q96M83	0.044	0.036	2.488E-2	1385	0.119	0.090	Q96M83.pdb.gz	CCDC7_HUMAN Coiled-coil domain-containing protein 7 OS=Homo sapiens OX=9606 GN=CCDC7 PE=1 SV=3
11	PDB:7myoB	0.098	0.306	7.206E-1	286	0.017	0.063	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
12	PDB:8dcxB	0.080	0.296	1.039	236	0.019	0.085	8dcxB.pdb.gz
13	PDB:6s1kE	0.071	0.480	2.033	102	0.015	0.157	6s1kE.pdb.gz
14	PDB:6mdmH	0.064	0.291	2.297	147	0.017	0.122	6mdmH.pdb.gz	Structural principles of SNARE complex recognition by the AAA+ protein NSF.
15	PDB:5u1dB	0.076	0.138	2.933	552	0.016	0.031	5u1dB.pdb.gz
16	PDB:5nikD	0.069	0.181	3.117	340	0.010	0.029	5nikD.pdb.gz
17	PDB:3favC	0.065	0.442	3.313	90	0.011	0.133	3favC.pdb.gz	WXG100 protein superfamily consists of three subfamilies and exhibits an alpha-helical C-terminal conserved residue pattern.
18	PDB:7vdvX	0.047	0.164	3.743	252	0.033	0.135	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
19	PDB:1wa8B	0.062	0.477	3.979	95	0.015	0.168	1wa8B.pdb.gz
20	PDB:4ad7A	0.055	0.129	4.229	358	0.016	0.047	4ad7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PHV5	5.67e-28	124	1237	0.060	0.051	E9PHV5_HUMAN ITPR interacting domain containing 2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=1
2	P28290	6.21e-28	124	1259	0.060	0.050	ITPI2_HUMAN Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=3
3	Q3U132	3.30e-12	72.4	458	0.047	0.107	TESP1_MOUSE Protein TESPA1 OS=Mus musculus OX=10090 GN=Tespa1 PE=1 SV=1
4	A2RU30	1.63e-10	67.4	521	0.036	0.073	TESP1_HUMAN Protein TESPA1 OS=Homo sapiens OX=9606 GN=TESPA1 PE=1 SV=2
5	E9PM24	4.39e-08	53.5	80	0.026	0.338	E9PM24_HUMAN Thymocyte expressed, positive selection associated 1 (Fragment) OS=Homo sapiens OX=9606 GN=TESPA1 PE=1 SV=1
6	E9PPW8	6.16e-08	53.9	100	0.026	0.270	E9PPW8_HUMAN Thymocyte expressed, positive selection associated 1 (Fragment) OS=Homo sapiens OX=9606 GN=TESPA1 PE=1 SV=1
7	E7EUL7	0.002	45.1	768	0.022	0.030	E7EUL7_HUMAN ITPR interacting domain containing 2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=1
8	O60271	0.49	37.0	1321	0.041	0.033	JIP4_HUMAN C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4
9	A0A8I6B3N0	0.52	37.0	1321	0.041	0.033	A0A8I6B3N0_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
10	Q58A65	0.52	37.0	1321	0.041	0.033	JIP4_MOUSE C-Jun-amino-terminal kinase-interacting protein 4 OS=Mus musculus OX=10090 GN=Spag9 PE=1 SV=2
11	A0A8I6AXC7	0.54	37.0	1305	0.039	0.031	A0A8I6AXC7_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
12	E9PSJ4	0.56	36.6	1324	0.041	0.032	E9PSJ4_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=3
13	A0A8I5ZJK4	0.57	36.6	1334	0.041	0.032	A0A8I5ZJK4_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
14	A0A0G2K6E8	0.69	36.6	1352	0.041	0.032	A0A0G2K6E8_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
15	Q09775	4.7	33.5	481	0.033	0.071	ROK1_SCHPO ATP-dependent RNA helicase rok1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rok1 PE=3 SV=1
16	Q9NYC9	4.7	33.9	4486	0.019	0.004	DYH9_HUMAN Dynein axonemal heavy chain 9 OS=Homo sapiens OX=9606 GN=DNAH9 PE=1 SV=3
17	Q90XH3	5.5	32.0	158	0.016	0.108	RBTN2_XENLA Rhombotin-2 OS=Xenopus laevis OX=8355 GN=lmo2 PE=2 SV=1
18	Q22342	6.9	33.1	1338	0.027	0.021	Q22342_CAEEL Autophagy-related protein 11 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=epg-7 PE=1 SV=2
19	Q8SYK5	8.8	32.3	376	0.022	0.061	INSV_DROME Protein insensitive OS=Drosophila melanogaster OX=7227 GN=insv PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07798 CCDC90-like	5.5	18.4	Coiled-coil domain-containing protein 90-like
2	PF14722 KRAP_IP3R_bind	3.4e-66	232.9	Ki-ras-induced actin-interacting protein-IP3R-interacting domain
3	PF03954 Lectin_N	6.8e+02	11.5	Hepatic lectin, N-terminal domain
4	PF14723 SSFA2_C	1.8e-09	49.1	Sperm-specific antigen 2 C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000032556

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000012200	0.694	Vacuolar protein sorting 13 homolog C (S. cerevisiae)
2	9598.ENSPTRP00000003591	0.668	TAR (HIV-1) RNA binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.544	organic cyclic compound binding
GO:1901363	0.526	heterocyclic compound binding
GO:0008092	0.360	cytoskeletal protein binding
GO:0003824	0.318	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.971	regulation of cellular process
GO:0009987	0.916	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005829	0.992	cytosol
GO:0043226	0.976	organelle
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:0005634	0.948	nucleus
GO:0016020	0.857	membrane
GO:0070013	0.339	intracellular organelle lumen
GO:0071944	0.330	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]