StarFunc result for job id Q6ZRV2

User Input

>input (1179 residues)
MARRSQSSSQGDNPLAPGYLPPHYKEYYRLAVDALAEGGSEAYSRFLATEGAPDFLCPEE
LEHVSRHLRPPQYVTREPPEGSLLDVDMDGSSGTYWPVNSDQAVPELDLGWPLTFGFQGT
EVTTLVQPPPPDSPSIKDEARRMIRSAQQVVAVVMDMFTDVDLLSEVLEAAARRVPVYIL
LDEMNAQHFLDMADKCRVNLQHVDFLRVRTVAGPTYYCRTGKSFKGHVKEKFLLVDCAVV
MSGSYSFMWSFEKIHRSLAHVFQGELVSSFDEEFRILFAQSEPLVPSAAALARMDAYALA
PYAGAGPLVGVPGVGAPTPFSFPKRAHLLFPPPREEGLGFPSFLDPDRHFLSAFRREEPP
RMPGGALEPHAGLRPLSRRLEAEAGPAGELAGARGFFQARHLEMDAFKRHSFATEGAGAV
ENFAAARQVSRQTFLSHGDDFRFQTSHFHRDQLYQQQYQWDPQLTPARPQGLFEKLRGGR
AGFADPDDFTLGAGPRFPELGPDGHQRLDYVPSSASREVRHGSDPAFAPGPRGLEPSGAP
RPNLTQRFPCQAAARPGPDPAPEAEPERRGGPEGRAGLRRWRLASYLSGCHGEDGGDDGL
PAPMEAEAYEDDVLAPGGRAPAGDLLPSAFRVPAAFPTKVPVPGPGSGGNGPEREGPEEP
GLAKQDSFRSRLNPLVQRSSRLRSSLIFSTSQAEGAAGAAAATEKVQLLHKEQTVSETLG
PGGEAVRSAASTKVAELLEKYKGPARDPGGGAGAITVASHSKAVVSQAWREEVAAPGAVG
GERRSLESCLLDLRDSFAQQLHQEAERQPGAASLTAAQLLDTLGRSGSDRLPSRFLSAQS
HSTSPQGLDSPLPLEGSGAHQVLHNESKGSPTSAYPERKGSPTPGFSTRRGSPTTGFIEQ
KGSPTSAYPERRGSPVPPVPERRSSPVPPVPERRGSLTLTISGESPKAGPAEEGPSGPME
VLRKGSLRLRQLLSPKGERRMEDEGGFPVPQENGQPESPRRLSLGQGDSTEAATEERGPR
ARLSSATANALYSSNLRDDTKAILEQISAHGQKHRAVPAPSPGPTHNSPELGRPPAAGVL
APDMSDKDKCSAIFRSDSLGTQGRLSRTLPASAEERDRLLRRMESMRKEKRVYSRFEVFC
KKEEASSPGAGEGPAEEGTRDSKVGKFVPKILGTFKSKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZRV2	0.999	0.999	0.000	1179	1.000	1.000	Q6ZRV2.pdb.gz	FA83H_HUMAN Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3
2	AFDB:Q5T0W9	0.228	0.264	3.386E-38	1011	0.218	0.254	Q5T0W9.pdb.gz	FA83B_HUMAN Protein FAM83B OS=Homo sapiens OX=9606 GN=FAM83B PE=1 SV=1
3	PDB:6kz8A	0.095	0.137	2.586E-5	784	0.020	0.031	6kz8A.pdb.gz	Crystal structure of plant PLD alpha 1 reveals catalytic and regulatory mechanisms of eukaryotic phospholipase D.
4	PDB:1xdpA	0.080	0.135	4.402E-5	687	0.022	0.038	1xdpA.pdb.gz	Crystal structure of a polyphosphate kinase and its implications for polyphosphate synthesis
5	PDB:7wdkA	0.102	0.134	1.930E-4	867	0.039	0.053	7wdkA.pdb.gz
6	PDB:7v55A	0.104	0.153	2.047E-4	781	0.015	0.023	7v55A.pdb.gz	Structural insights into PA3488-mediated inactivation of Pseudomonas aeruginosa PldA.
7	PDB:7v53A	0.092	0.115	8.460E-4	930	0.018	0.023	7v53A.pdb.gz
8	PDB:1q32B	0.079	0.190	3.496E-3	420	0.016	0.045	1q32B.pdb.gz
9	AFDB:Q9Z0Y7	0.049	0.048	1.090E-2	1216	0.160	0.155	Q9Z0Y7.pdb.gz	IRS4_MOUSE Insulin receptor substrate 4 OS=Mus musculus OX=10090 GN=Irs4 PE=1 SV=2
10	AFDB:Q8QGQ8	0.034	0.031	1.968E-2	1344	0.110	0.097	Q8QGQ8.pdb.gz	PER2_CHICK Period circadian protein homolog 2 OS=Gallus gallus OX=9031 GN=PER2 PE=2 SV=1
11	AFDB:P40477	0.040	0.039	3.158E-2	1460	0.103	0.084	P40477.pdb.gz	NU159_YEAST Nucleoporin NUP159 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP159 PE=1 SV=1
12	AFDB:Q702N8	0.057	0.043	3.554E-2	1843	0.164	0.105	Q702N8.pdb.gz	XIRP1_HUMAN Xin actin-binding repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=XIRP1 PE=1 SV=1
13	AFDB:F4HTH8	0.033	0.033	5.067E-2	1181	0.107	0.107	F4HTH8.pdb.gz	KTN82_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 OS=Arabidopsis thaliana OX=3702 GN=KTN80.2 PE=1 SV=1
14	AFDB:O15055	0.039	0.037	8.627E-2	1255	0.120	0.112	O15055.pdb.gz	PER2_HUMAN Period circadian protein homolog 2 OS=Homo sapiens OX=9606 GN=PER2 PE=1 SV=2
15	AFDB:A0A0A0MSA4	0.045	0.049	1.093E-1	1046	0.118	0.133	A0A0A0MSA4.pdb.gz	A0A0A0MSA4_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
16	AFDB:P34127	0.043	0.042	1.230E-1	1230	0.092	0.089	P34127.pdb.gz	MYBA_DICDI Myb-like protein A OS=Dictyostelium discoideum OX=44689 GN=mybA PE=4 SV=2
17	PDB:1httA	0.047	0.114	1.730E-1	366	0.017	0.055	1httA.pdb.gz	Crystal structure of histidyl-tRNA synthetase from Escherichia coli complexed with histidyl-adenylate.
18	PDB:3a25A	0.052	0.188	1.730E-1	264	0.019	0.083	3a25A.pdb.gz	Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2
19	PDB:7r04B	0.047	0.030	2.617E-1	2229	0.014	0.008	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
20	PDB:4bqhA	0.056	0.113	2.945E-1	521	0.009	0.021	4bqhA.pdb.gz	A Novel Allosteric Inhibitor of the Uridine Diphosphate N-Acetylglucosamine Pyrophosphorylase from Trypanosoma Brucei.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZRV2	0.0	2356	1179	1.000	1.000	FA83H_HUMAN Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3
2	Q5T0W9	4.30e-79	283	1011	0.119	0.138	FA83B_HUMAN Protein FAM83B OS=Homo sapiens OX=9606 GN=FAM83B PE=1 SV=1
3	A6ND36	1.24e-48	189	823	0.087	0.125	FA83G_HUMAN Protein FAM83G OS=Homo sapiens OX=9606 GN=FAM83G PE=1 SV=2
4	Q9BQN1	1.12e-47	185	747	0.086	0.135	FA83C_HUMAN Protein FAM83C OS=Homo sapiens OX=9606 GN=FAM83C PE=1 SV=3
5	Q86UY5	9.21e-47	176	434	0.087	0.235	FA83A_HUMAN Protein FAM83A OS=Homo sapiens OX=9606 GN=FAM83A PE=1 SV=1
6	Q9H4H8	6.00e-46	177	585	0.090	0.181	FA83D_HUMAN Protein FAM83D OS=Homo sapiens OX=9606 GN=FAM83D PE=1 SV=3
7	A0A087WXK8	1.06e-45	177	615	0.090	0.172	A0A087WXK8_HUMAN Chromosome 20 open reading frame 129 OS=Homo sapiens OX=9606 GN=FAM83D PE=1 SV=1
8	Q2M2I3	3.12e-45	172	478	0.091	0.224	FA83E_HUMAN Protein FAM83E OS=Homo sapiens OX=9606 GN=FAM83E PE=1 SV=2
9	Q8NEG4	4.38e-45	173	500	0.087	0.206	FA83F_HUMAN Protein FAM83F OS=Homo sapiens OX=9606 GN=FAM83F PE=1 SV=1
10	Q8IHN4	8.6	33.1	6093	0.043	0.008	Q8IHN4_PLAF7 Antigen 332, DBL-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1149000 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07894 FAM83	1.1e-97	338.5	FAM83 A-H
2	PF13091 PLDc_2	0.64	21.4	PLD-like domain
3	PF11495 Regulator_TrmB	4.3e+02	11.5	Archaeal transcriptional regulator TrmB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373565

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000421689	0.939	Casein kinase I isoform alpha
2	9606.ENSP00000379619	0.886	WD repeat-containing protein 72
3	9606.ENSP00000379383	0.819	Enamelin
4	9606.ENSP00000389870	0.807	Homeobox protein DLX-3
5	9606.ENSP00000406925	0.802	Odontogenesis associated phosphoprotein
6	9606.ENSP00000260228	0.801	Matrix metalloproteinase-20
7	9606.ENSP00000380044	0.780	Casein kinase I isoform epsilon
8	9606.ENSP00000370088	0.765	Amelogenin, X isoform
9	9606.ENSP00000431840	0.753	Sodium/potassium/calcium exchanger 4
10	9606.ENSP00000326159	0.721	Kallikrein-4
11	9606.ENSP00000468308	0.696	Pseudokinase FAM20A
12	9606.ENSP00000313809	0.689	Ameloblastin
13	9606.ENSP00000375778	0.661	Laminin subunit beta-3
14	9606.ENSP00000337816	0.654	Matrix metalloproteinase-25
15	9606.ENSP00000341013	0.654	Amelotin
16	9606.ENSP00000364831	0.649	Chloride channel protein ClC-Kb
17	9606.ENSP00000270593	0.633	Testicular acid phosphatase
18	9606.ENSP00000417581	0.617	Protein FAM199X
19	9606.ENSP00000324464	0.616	Casein kinase I isoform delta
20	9606.ENSP00000366275	0.577	Metal transporter CNNM4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:1990254	0.995	keratin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0051179	0.975	localization
GO:0048518	0.949	positive regulation of biological process
GO:0033365	0.948	protein localization to organelle
GO:0044380	0.920	protein localization to cytoskeleton
GO:0071840	0.806	cellular component organization or biogenesis
GO:0048522	0.799	positive regulation of cellular process
GO:0016043	0.780	cellular component organization
GO:0006996	0.625	organelle organization
GO:0007010	0.513	cytoskeleton organization
GO:0040012	0.394	regulation of locomotion
GO:0030334	0.317	regulation of cell migration
GO:2000147	0.315	positive regulation of cell motility
GO:0030335	0.305	positive regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005882	0.995	intermediate filament
GO:0045095	0.991	keratin filament
GO:0005737	0.945	cytoplasm
GO:0005829	0.797	cytosol
GO:0043231	0.775	intracellular membrane-bounded organelle
GO:0005634	0.430	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]