StarFunc result for job id Q6ZS10

User Input

>input (378 residues)
MHNLYSITGYPDPPGTMEEEEEDDDYENSTPPYKDLPPKPGTMEEEEEDDDYENSTPPYK
DLPPKPGTMEEEEEDDDYENSTPPYKDLPPKPGSSAPPRPPRAAKETEKPPLPCKPRNMT
GLDLAAVTCPPPQLAVNLEPSPLQPSLAATPVPWLNQRSGGPGCCQKRWMVYLCLLVVTS
LFLGCLGLTVTLIKYQELMEELRMLSFQQMTWRTNMTGMAGLAGLKHDIARVRADTNQSL
VELWGLLDCRRITCPEGWLPFEGKCYYFSPSTKSWDEARMFCQENYSHLVIINSFAEHNF
VAKAHGSPRVYWLGLNDRAQEGDWRWLDGSPVTLSFWEPEEPNNIHDEDCATMNKGGTWN
DLSCYKTTYWICERKCSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZS10	1.000	1.000	1.251E-62	378	1.000	1.000	Q6ZS10.pdb.gz	CL17A_HUMAN C-type lectin domain family 17, member A OS=Homo sapiens OX=9606 GN=CLEC17A PE=1 SV=2
2	AFDB:Q14FK5	0.330	0.486	1.626E-18	255	0.201	0.298	Q14FK5.pdb.gz	Q14FK5_MOUSE SIGNR7 protein OS=Mus musculus OX=10090 GN=Cd209g PE=2 SV=1
3	PDB:7wz8A	0.293	0.600	2.467E-13	180	0.148	0.311	7wz8A.pdb.gz
4	PDB:1qddA	0.313	0.783	1.097E-12	144	0.108	0.285	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
5	PDB:5f2qB	0.299	0.787	7.404E-12	135	0.098	0.274	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
6	AFDB:Q98TA4	0.305	0.449	1.825E-11	254	0.143	0.213	Q98TA4.pdb.gz	MBL_CHICK Mannose-binding protein OS=Gallus gallus OX=9031 GN=MBL PE=2 SV=2
7	PDB:1htnA	0.301	0.700	2.223E-10	156	0.106	0.256	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
8	PDB:4mthA	0.293	0.744	2.359E-10	139	0.103	0.281	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
9	PDB:3bx4C	0.242	0.643	5.441E-10	134	0.103	0.291	3bx4C.pdb.gz
10	PDB:1bj3A	0.253	0.705	1.691E-9	129	0.108	0.318	1bj3A.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
11	PDB:7qsrA	0.294	0.086	2.568E-9	1335	0.095	0.027	7qsrA.pdb.gz
12	PDB:1gz2A	0.295	0.758	2.726E-9	139	0.098	0.266	1gz2A.pdb.gz
13	PDB:1bj3B	0.252	0.734	4.951E-9	123	0.082	0.252	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
14	AFDB:A0A2R8QK78	0.315	0.078	1.745E-8	1570	0.183	0.044	A0A2R8QK78.pdb.gz
15	AFDB:Q0P6C8	0.208	0.233	3.887E-7	326	0.156	0.181	Q0P6C8.pdb.gz	Q0P6C8_MOUSE Cd209f protein (Fragment) OS=Mus musculus OX=10090 GN=Cd209f PE=2 SV=1
16	AFDB:P28739	0.127	0.070	1.958E-1	770	0.108	0.053	P28739.pdb.gz	KLPA_EMENI Kinesin-like protein klpA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=klpA PE=2 SV=3
17	AFDB:Q7SZL5	0.172	0.055	1.958E-1	1338	0.114	0.032	Q7SZL5.pdb.gz	MTUS1_XENLA Microtubule-associated tumor suppressor 1 homolog OS=Xenopus laevis OX=8355 GN=mtus1 PE=1 SV=1
18	AFDB:Q8IMB9	0.169	0.098	2.639E-1	743	0.101	0.051	Q8IMB9.pdb.gz	Q8IMB9_DROME FI03013p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1674 PE=1 SV=1
19	AFDB:Q9FGJ1	0.174	0.168	2.801E-1	398	0.153	0.146	Q9FGJ1.pdb.gz	Q9FGJ1_ARATH Homeodomain-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MNJ7.25 PE=1 SV=1
20	AFDB:E2JKZ0	0.148	0.053	2.974E-1	1351	0.119	0.033	E2JKZ0.pdb.gz	E2JKZ0_CAEEL Dynactin subunit 1 OS=Caenorhabditis elegans OX=6239 GN=dnc-1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZS10	0.0	780	378	1.000	1.000	CL17A_HUMAN C-type lectin domain family 17, member A OS=Homo sapiens OX=9606 GN=CLEC17A PE=1 SV=2
2	Q9H2X3	4.03e-29	118	399	0.151	0.143	CLC4M_HUMAN C-type lectin domain family 4 member M OS=Homo sapiens OX=9606 GN=CLEC4M PE=1 SV=1
3	Q91ZX1	4.79e-29	114	238	0.148	0.235	C209A_MOUSE CD209 antigen-like protein A OS=Mus musculus OX=10090 GN=Cd209a PE=2 SV=1
4	D3Z5D4	1.52e-28	112	194	0.135	0.263	D3Z5D4_MOUSE CD209g antigen OS=Mus musculus OX=10090 GN=Cd209g PE=4 SV=1
5	Q67EQ1	5.22e-28	111	215	0.146	0.256	CLC4E_RAT C-type lectin domain family 4 member E OS=Rattus norvegicus OX=10116 GN=Clec4e PE=1 SV=1
6	Q14FK5	5.48e-28	112	255	0.135	0.200	Q14FK5_MOUSE SIGNR7 protein OS=Mus musculus OX=10090 GN=Cd209g PE=2 SV=1
7	Q91ZW8	5.82e-28	112	237	0.140	0.224	C209D_MOUSE CD209 antigen-like protein D OS=Mus musculus OX=10090 GN=Cd209d PE=2 SV=1
8	Q9NNX6	4.28e-27	113	404	0.140	0.131	CD209_HUMAN CD209 antigen OS=Homo sapiens OX=9606 GN=CD209 PE=1 SV=1
9	Q91ZW7	6.38e-27	108	208	0.135	0.245	C209E_MOUSE CD209 antigen-like protein E OS=Mus musculus OX=10090 GN=Cd209e PE=2 SV=1
10	Q9ULY5	2.55e-26	107	219	0.146	0.251	CLC4E_HUMAN C-type lectin domain family 4 member E OS=Homo sapiens OX=9606 GN=CLEC4E PE=1 SV=1
11	P20693	3.11e-26	109	331	0.180	0.205	FCER2_MOUSE Low affinity immunoglobulin epsilon Fc receptor OS=Mus musculus OX=10090 GN=Fcer2 PE=1 SV=1
12	Q8K4Q8	4.13e-26	112	742	0.135	0.069	COL12_MOUSE Collectin-12 OS=Mus musculus OX=10090 GN=Colec12 PE=1 SV=1
13	P49300	6.56e-26	107	304	0.153	0.191	CLC10_MOUSE C-type lectin domain family 10 member A OS=Mus musculus OX=10090 GN=Clec10a PE=1 SV=1
14	Q8BNX1	8.76e-26	107	294	0.159	0.204	CLC4G_MOUSE C-type lectin domain family 4 member G OS=Mus musculus OX=10090 GN=Clec4g PE=1 SV=1
15	P34927	9.13e-26	107	284	0.143	0.190	ASGR1_MOUSE Asialoglycoprotein receptor 1 OS=Mus musculus OX=10090 GN=Asgr1 PE=1 SV=4
16	P06734	1.28e-25	107	321	0.180	0.212	FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor OS=Homo sapiens OX=9606 GN=FCER2 PE=1 SV=1
17	Q4KL16	2.10e-25	105	262	0.132	0.191	Q4KL16_MOUSE Cd209f protein (Fragment) OS=Mus musculus OX=10090 GN=Cd209f PE=2 SV=1
18	G3UVT9	2.29e-25	105	255	0.132	0.196	G3UVT9_MOUSE CD209f antigen OS=Mus musculus OX=10090 GN=Cd209f PE=1 SV=1
19	D3Z1H5	2.35e-25	105	274	0.132	0.182	D3Z1H5_MOUSE CD209f antigen OS=Mus musculus OX=10090 GN=Cd209f PE=1 SV=1
20	Q7TSU6	2.42e-25	105	260	0.132	0.192	Q7TSU6_MOUSE Cd209f protein (Fragment) OS=Mus musculus OX=10090 GN=Cd209f PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00059 Lectin_C	6.1e-22	89.7	Lectin C-type domain
2	PF05473 UL45	1.2e+02	13.7	UL45 protein, carbohydrate-binding C-type lectin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393719

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000224337	0.662	B-cell linker protein
2	9606.ENSP00000359052	0.628	Protein FAM102B
3	9606.ENSP00000341905	0.578	RAS protein activator like-3
4	9606.ENSP00000470262	0.554	Trafficking protein particle complex subunit 5
5	9606.ENSP00000352071	0.538	Scavenger receptor cysteine-rich type 1 protein M130
6	9606.ENSP00000370021	0.538	Centlein
7	9606.ENSP00000261226	0.506	Transmembrane and coiled-coil domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0042806	1.000	fucose binding
GO:0005537	1.000	mannose binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0009987	0.972	cellular process
GO:0050896	0.967	response to stimulus
GO:0050794	0.948	regulation of cellular process
GO:0048518	0.883	positive regulation of biological process
GO:0048522	0.552	positive regulation of cellular process
GO:0019222	0.544	regulation of metabolic process
GO:0048583	0.525	regulation of response to stimulus
GO:0051716	0.472	cellular response to stimulus
GO:0002376	0.463	immune system process
GO:0060255	0.458	regulation of macromolecule metabolic process
GO:0051239	0.448	regulation of multicellular organismal process
GO:0007154	0.427	cell communication
GO:0002682	0.419	regulation of immune system process
GO:0007165	0.419	signal transduction
GO:0002684	0.360	positive regulation of immune system process
GO:0009893	0.342	positive regulation of metabolic process
GO:0010604	0.326	positive regulation of macromolecule metabolic process
GO:0048519	0.309	negative regulation of biological process
GO:0051240	0.300	positive regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.987	membrane
GO:0009986	0.987	cell surface
GO:0005886	0.976	plasma membrane
GO:0005829	0.399	cytosol
GO:0043227	0.383	membrane-bounded organelle
GO:0043231	0.332	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]