StarFunc result for job id Q6ZS17

User Input

>input (1223 residues)
MMSLSVRPQRRLLSARVNRSQSFAGVLGSHERGPSLSFRSFPVFSPPGPPRKPPALSRVS
RMFSVAHPAAKVPQPERLDLVYTALKRGLTAYLEVHQQEQEKLQGQIRESKRNSRLGFLY
DLDKQVKSIERFLRRLEFHASKIDELYEAYCVQRRLRDGAYNMVRAYTTGSPGSREARDS
LAEATRGHREYTESMCLLESELEAQLGEFHLRMKGLAGFARLCVGDQYEICMKYGRQRWK
LRGRIEGSGKQVWDSEETIFLPLLTEFLSIKVTELKGLANHVVVGSVSCETKDLFAALPQ
VVAVDINDLGTIKLSLEVTWSPFDKDDQPSAASSVNKASTVTKRFSTYSQSPPDTPSLRE
QAFYNMLRRQEELENGTAWSLSSESSDDSSSPQLSGTARHSPAPRPLVQQPEPLPIQVAF
RRPETPSSGPLDEEGAVAPVLANGHAPYSRTLSHISEASVDAALAEASVEAVGPESLAWG
PSPPTHPAPTHGEHPSPVPPALDPGHSATSSTLGTTGSVPTSTDPAPSAHLDSVHKSTDS
GPSELPGPTHTTTGSTYSAITTTHSAPSPLTHTTTGSTHKPIISTLTTTGPTLNIIGPVQ
TTTSPTHTMPSPTHTTASPTHTSTSPTHTPTSPTHKTSMSPPTTTSPTPSGMGLVQTATS
PTHPTTSPTHPTTSPILINVSPSTSLELATLSSPSKHSDPTLPGTDSLPCSPPVSNSYTQ
ADPMAPRTPHPSPAHSSRKPLTSPAPDPSESTVQSLSPTPSPPTPAPQHSDLCLAMAVQT
PVPTAAGGSGDRSLEEALGALMAALDDYRGQFPELQGLEQEVTRLESLLMQRQGLTRSRA
SSLSITVEHALESFSFLNEDEDEDNDVPGDRPPSSPEAGAEDSIDSPSARPLSTGCPALD
AALVRHLYHCSRLLLKLGTFGPLRCQEAWALERLLREARVLEAVCEFSRRWEIPASSAQE
VVQFSASRPGFLTFWDQCTERLSCFLCPVERVLLTFCNQYGARLSLRQPGLAEAVCVKFL
EDALGQKLPRRPQPGPGEQLTVFQFWSFVETLDSPTMEAYVTETAEEVLLVRNLNSDDQA
VVLKALRLAPEGRLRRDGLRALSSLLVHGNNKVMAAVSTQLRSLSLGPTFRERALLCFLD
QLEDEDVQTRVAGCLALGCIKAPEGIEPLVYLCQTDTEAVREAARQSLQQCGEEGQSAHR
RLEESLDALPRIFGPGSMASTAF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q68FE6	0.482	0.482	0.000	1223	0.808	0.808	Q68FE6.pdb.gz	RIPR1_MOUSE Rho family-interacting cell polarization regulator 1 OS=Mus musculus OX=10090 GN=Ripor1 PE=1 SV=2
2	AFDB:Q6ZS17	1.000	1.000	0.000	1223	1.000	1.000	Q6ZS17.pdb.gz	RIPR1_HUMAN Rho family-interacting cell polarization regulator 1 OS=Homo sapiens OX=9606 GN=RIPOR1 PE=1 SV=1
3	AFDB:Q9C6S1	0.064	0.063	6.161E-6	1230	0.141	0.140	Q9C6S1.pdb.gz	FH14_ARATH Formin-like protein 14 OS=Arabidopsis thaliana OX=3702 GN=FH14 PE=3 SV=3
4	AFDB:Q9P2P5	0.080	0.064	1.436E-4	1572	0.128	0.100	Q9P2P5.pdb.gz	HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens OX=9606 GN=HECW2 PE=1 SV=2
5	AFDB:Q8R361	0.091	0.160	5.848E-4	645	0.083	0.157	Q8R361.pdb.gz	RFIP5_MOUSE Rab11 family-interacting protein 5 OS=Mus musculus OX=10090 GN=Rab11fip5 PE=1 SV=2
6	AFDB:A2AP18	0.083	0.069	1.556E-3	1501	0.087	0.071	A2AP18.pdb.gz	PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus OX=10090 GN=Plch2 PE=1 SV=2
7	AFDB:E7F8A0	0.061	0.077	1.624E-3	903	0.101	0.137	E7F8A0.pdb.gz
8	AFDB:Q9BXF6	0.097	0.170	1.695E-3	653	0.082	0.153	Q9BXF6.pdb.gz	RFIP5_HUMAN Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1
9	AFDB:F1QH49	0.067	0.063	2.706E-3	1325	0.125	0.115	F1QH49.pdb.gz
10	AFDB:Q54WA7	0.088	0.117	3.645E-3	785	0.097	0.152	Q54WA7.pdb.gz	Q54WA7_DICDI RNA binding protein OS=Dictyostelium discoideum OX=44689 GN=pufA PE=4 SV=1
11	PDB:1cjyA	0.080	0.148	6.616E-3	633	0.013	0.025	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
12	PDB:7sn8D	0.091	0.216	7.844E-3	399	0.052	0.158	7sn8D.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
13	PDB:5a50A	0.081	0.475	8.912E-3	165	0.020	0.152	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
14	PDB:7dvqK	0.079	0.341	1.485E-2	188	0.021	0.138	7dvqK.pdb.gz	Structure of the activated human minor spliceosome.
15	PDB:4rj9A	0.081	0.477	1.550E-2	161	0.018	0.137	4rj9A.pdb.gz
16	PDB:7rroH7	0.095	0.161	1.837E-2	580	0.065	0.138	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
17	PDB:5a52A	0.083	0.545	1.917E-2	154	0.016	0.123	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:4tnmA	0.088	0.218	3.061E-2	407	0.038	0.113	4tnmA.pdb.gz
19	PDB:5iz5A	0.081	0.127	4.685E-2	757	0.009	0.015	5iz5A.pdb.gz
20	PDB:5tbkA	0.081	0.187	5.101E-2	417	0.032	0.094	5tbkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68FE6	0.0	1833	1223	0.809	0.809	RIPR1_MOUSE Rho family-interacting cell polarization regulator 1 OS=Mus musculus OX=10090 GN=Ripor1 PE=1 SV=2
2	Q6ZS17	0.0	2470	1223	1.000	1.000	RIPR1_HUMAN Rho family-interacting cell polarization regulator 1 OS=Homo sapiens OX=9606 GN=RIPOR1 PE=1 SV=1
3	Q9Y4F9	2.12e-135	442	1068	0.171	0.196	RIPR2_HUMAN Rho family-interacting cell polarization regulator 2 OS=Homo sapiens OX=9606 GN=RIPOR2 PE=1 SV=4
4	Q80U16	1.85e-134	439	1078	0.170	0.193	RIPR2_MOUSE Rho family-interacting cell polarization regulator 2 OS=Mus musculus OX=10090 GN=Ripor2 PE=1 SV=2
5	A9ZLX4	1.92e-131	431	1072	0.168	0.191	RIPR2_COTJA Rho family-interacting cell polarization regulator 2 OS=Coturnix japonica OX=93934 GN=RIPOR2 PE=1 SV=1
6	Q1LU99	1.72e-126	418	1083	0.166	0.187	RIPR2_DANRE Rho family-interacting cell polarization regulator 2 OS=Danio rerio OX=7955 GN=ripor2 PE=2 SV=1
7	Q7TP54	2.64e-109	375	1310	0.165	0.154	RIPR2_RAT Rho family-interacting cell polarization regulator 2 OS=Rattus norvegicus OX=10116 GN=Ripor2 PE=1 SV=1
8	Q96MK2	2.11e-95	329	946	0.140	0.181	RIPR3_HUMAN RIPOR family member 3 OS=Homo sapiens OX=9606 GN=RIPOR3 PE=1 SV=4
9	M9PC48	1.02e-07	59.3	18095	0.083	0.006	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	P16356	5.11e-06	53.5	1856	0.048	0.032	RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans OX=6239 GN=ama-1 PE=1 SV=3
11	P24928	1.49e-05	52.0	1970	0.034	0.021	RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2
12	A0A8I6ASE2	1.63e-05	52.0	1956	0.034	0.021	A0A8I6ASE2_RAT DNA-directed RNA polymerase subunit OS=Rattus norvegicus OX=10116 GN=Polr2a PE=1 SV=1
13	D4A5A6	1.63e-05	52.0	1970	0.034	0.021	D4A5A6_RAT DNA-directed RNA polymerase subunit OS=Rattus norvegicus OX=10116 GN=Polr2a PE=1 SV=1
14	P08775	2.76e-05	51.2	1970	0.031	0.019	RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus OX=10090 GN=Polr2a PE=1 SV=3
15	O77375	1.01e-04	49.3	2457	0.043	0.021	O77375_PLAF7 DNA-directed RNA polymerase subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0318200 PE=3 SV=1
16	G3MZY8	0.035	40.8	1970	0.043	0.027	G3MZY8_BOVIN DNA-directed RNA polymerase subunit OS=Bos taurus OX=9913 GN=POLR2A PE=1 SV=2
17	P04052	0.13	39.3	1887	0.032	0.021	RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster OX=7227 GN=RpII215 PE=3 SV=4
18	Q8IIK5	0.64	37.0	1201	0.083	0.085	Q8IIK5_PLAF7 Rhoptry neck protein 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1116000 PE=4 SV=2
19	Q94246	0.64	37.0	2153	0.025	0.014	Q94246_CAEEL ET module OS=Caenorhabditis elegans OX=6239 GN=gfi-1 PE=1 SV=1
20	J3KPG5	4.8	33.9	1875	0.041	0.027	J3KPG5_HUMAN Bromodomain adjacent to zinc finger domain 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13646 HEAT_2	0.0039	28.9	HEAT repeats
2	PF02185 HR1	3.6	19.0	Hr1 repeat
3	PF15903 PL48	1.8e-168	571.5	Filopodia upregulated, FAM65

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400099

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377036	0.648	Serine/threonine-protein phosphatase 2A activator
2	9606.ENSP00000423897	0.639	Kelch-like protein 5
3	9606.ENSP00000317903	0.622	R3H domain containing 2
4	9606.ENSP00000432886	0.613	RNA-binding protein 40
5	9606.ENSP00000371614	0.584	Serine/threonine-protein kinase BRSK2
6	9606.ENSP00000366557	0.571	Crooked neck-like protein 1
7	9606.ENSP00000400175	0.567	Transforming protein RhoA
8	9606.ENSP00000307674	0.562	Soluble calcium-activated nucleotidase 1
9	9606.ENSP00000335636	0.544	N-alpha-acetyltransferase 20
10	9606.ENSP00000367330	0.520	Uncharacterized protein C12orf73
11	9606.ENSP00000367623	0.513	Heat shock 70 kDa protein 14
12	9606.ENSP00000372724	0.505	Lymphocyte antigen 6 complex locus protein G5c
13	9606.ENSP00000404247	0.505	ADP-ribosylation factor-like protein 17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0071889	1.000	14-3-3 protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0009987	0.983	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0050896	0.962	response to stimulus
GO:0007154	0.960	cell communication
GO:0051716	0.951	cellular response to stimulus
GO:0023051	0.918	regulation of signaling
GO:0010646	0.918	regulation of cell communication
GO:0023052	0.905	signaling
GO:0042221	0.878	response to chemical
GO:1990868	0.818	response to chemokine
GO:0048583	0.769	regulation of response to stimulus
GO:0048522	0.745	positive regulation of cellular process
GO:0009966	0.717	regulation of signal transduction
GO:1902531	0.704	regulation of intracellular signal transduction
GO:0065009	0.691	regulation of molecular function
GO:0051179	0.687	localization
GO:0007165	0.648	signal transduction
GO:0051056	0.638	regulation of small GTPase mediated signal transduction
GO:0051641	0.555	cellular localization
GO:0048519	0.521	negative regulation of biological process
GO:0006950	0.505	response to stress
GO:0044093	0.484	positive regulation of molecular function
GO:0048523	0.464	negative regulation of cellular process
GO:0050790	0.458	regulation of catalytic activity
GO:0035556	0.454	intracellular signal transduction
GO:0051336	0.450	regulation of hydrolase activity
GO:0033554	0.415	cellular response to stress
GO:0070887	0.409	cellular response to chemical stimulus
GO:0046578	0.394	regulation of Ras protein signal transduction
GO:0008104	0.388	protein localization
GO:0032879	0.386	regulation of localization
GO:0051234	0.382	establishment of localization
GO:0007265	0.347	Ras protein signal transduction
GO:0031668	0.343	cellular response to extracellular stimulus
GO:0035024	0.343	negative regulation of Rho protein signal transduction
GO:0034067	0.342	protein localization to Golgi apparatus
GO:0007266	0.342	Rho protein signal transduction
GO:0090316	0.341	positive regulation of intracellular protein transport
GO:0051099	0.328	positive regulation of binding
GO:0009611	0.327	response to wounding
GO:0051649	0.326	establishment of localization in cell
GO:0071345	0.320	cellular response to cytokine stimulus
GO:0031667	0.315	response to nutrient levels
GO:0043087	0.313	regulation of GTPase activity
GO:0030334	0.313	regulation of cell migration
GO:0031669	0.311	cellular response to nutrient levels
GO:1990869	0.311	cellular response to chemokine
GO:0044092	0.304	negative regulation of molecular function
GO:0051656	0.300	establishment of organelle localization
GO:0009267	0.300	cellular response to starvation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043226	0.986	organelle
GO:0043227	0.971	membrane-bounded organelle
GO:0043229	0.965	intracellular organelle
GO:0043231	0.962	intracellular membrane-bounded organelle
GO:0012505	0.960	endomembrane system
GO:0005576	0.956	extracellular region
GO:0016020	0.938	membrane
GO:0031982	0.825	vesicle
GO:0005615	0.790	extracellular space
GO:0031090	0.787	organelle membrane
GO:1903561	0.738	extracellular vesicle
GO:0070062	0.715	extracellular exosome
GO:0005794	0.605	Golgi apparatus
GO:0012506	0.456	vesicle membrane
GO:0005634	0.410	nucleus
GO:0031252	0.350	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]