StarFunc result for job id Q6ZS30

User Input

>input (2694 residues)
MASRERLFELWMLYCTKKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLP
DNILQVLRIQLLQCVQKMADGLEEQQQALSILLVKFFIILCRNLSNVEEIGTCSYINYVI
TMTTLYIQQLKSKKKEKEMADQTCIEEFVIHALAFCESLYDPYRNWRHRISGRILSTVEK
SRQKYKPASLTVEFVPFFYQCFQESEHLKESLKCCLLHLFGAIVAGGQRNALQAISPATM
EVLMRVLADCDSWEDGDPEEVGRKAELTLKCLTEVVHILLSSNSDQRQVETSTILENYFK
LLNSDHSALPNQRRSRQWENRFIALQIKMLNTITAMLDCTDRPVLQAIFLNSNCFEHLIR
LLQNCKVFQGQLDCLAISTIQALTAVMNKSPAAKEVFKERIGYTHMLEVLKSLGQPPLEL
LKELMNMAVEGDHTSVGILGISNVQPLLLLIQWLPELQSHDLQIFISDWLKRICCINRQS
RTTCVNANMGIRIIETLDLHSSLHQTCAENLIAIHGSLGSQSVSSEEIRRLLRLLRVDES
ESVHPYVTPVTRAILTMARKLSLESALQYFNLSHSMAGISVPPIQKWPGSAFSFSAWFCL
DQDQLTLGIANKGGKRKQLYSFFTGSGMGFEAFITHSGMLVVAVCTKREYATVMLPDHSF
CDSLWHNITVVHMPGKRPFGQSFVYIYDNGQQKVSAPLRFPAMNEPFTSCCIGSAGQRTT
TPPPSQIPDPPFSSPITPHRTSFGGILSSASWGGTIEKSKLITKLISAGTQDSEWGCPTS
LEGQLGSVIIFYEPLQPPQVKALYLAGPNCLSPWKCQESDMADLPGNILLYYTAKACKNS
ICLDLSTNCLHGRLTGNKVVNWDIKDIINCIGGLNVLFPLLEQISHFSEGQIPEEKNEST
VPESVTPVEGDWLVWTSTKASESRLERNLVATFILIVKHFIQRHPINQGNLIHSHGVATL
GALLQKVPSTLMDVNVLMAVQLLIEQVSLEKNMQLLQQMYQYLLFDFRIWNRGDFPFRIG
HIQYLSTIIKDSRRVFRKKYGVQFLLDTLRIYYGNGCKYNELSLDDIRTIRTSLYGLIKY
FLCKGGSHEEIQSIMGYIAATNEEEQLFGILDVLFSLLRTSPTRGQLFLLLFEPGNADIL
YALLLNQKYSDRLREIIFKIMEQMLKCTNVYERSKQHIRLREVGYSGLGLLLNEALVNTS
LIKNLTHQIINTDPVINFKDLLSVVYISHRAHINVRVAICRKVLQILQFQPDAAHQISQQ
VGWQDTLVRLFLKAKFENGNTLHKHSRAVLMKDNDKNMSTEDTKKNSDEKTDEEKITSFA
SANVSSDQWSLEDRHSLDSNTPLFPEDSSVGELSFKSENQEEFWHSNPSHLSLDLSGIDS
CEMSDSGSQVPDSLPSTPSPVESTKSFSVHSDRESSITNDMGFSDDFSLLESQERCEEEL
LQLLTHILNYVMCKGLEKSDDDTWIERGQVFSALSKPGISSELLRPSDEIKLTLLQKMLE
WAISENREAKTNPVTAENAFRLVLIIQDFLQSEGLVNSNMWTEKLLEDMMLLFDCLSVCY
SESPVWVKLSQIQIQLLLGFIGRGNLQVCAMASAKLNTLLQTKVIENQDEACYILGKLEH
VLSQSIKEQTEIYSFLIPLVRTLVSKIYELLFMNLHLPSLPFTNGSSSFFEDFQEYCNSN
EWQVYIEKYIVPYMKQYEAHTFYDGHENMALYWKDCYEALMVNMHKRDREGGESKLKFQE
LFVEPFNRKARQENLRYNNMLKQLSSQQLATLRRWKAIQLYLTCERGPWAKRKQNPIHWK
LANVENYSRMRLKLVPNYNFKTHEEASALRDNLGIQHSQPSSDTLLLEVVKQVKVSDMVE
DKLDLPEEDITARVNVDEKEEQDQKEKLVLMEDCELITIIDVIPGRLEITTQHIYFYDGS
IEKEDGVGFDFKWPHSQIREIHLRRYNLRRSALEIFHVDQSNYFLNFKKEVRNKIYSRLL
SLHSPNSYYGSRSPQELFKASGLTQKWVNREISNFDYLIQINTMAGRTYNDLAQYPVFPW
ILQDYTSEELDLNNPAVFRDLSKPIGVVNEKNAKAMREKYENFEDPMGTIDKFHYGTHYS
NSAGVMHYLIRVEPFTTLHIQLQSGRFDCADRQFHSIPATWQALMDNPYDVKELIPEFFY
FPEFLENQNQFNLGRLQISKELVNDVILPKWAKSAEDFIYKHRKALESEYVSAHLHEWID
LIFGYKQRGPAAVEALNVFYYCSYEGAVDLDALTDEKERKALEGMINNFGQTPCQLLKEP
HPPRLSAEEAVQKPTKIDTSTLNLFQHLPELKSFFIEGISDGIPLLKATIPKNQYRSFMS
QGSPELLITISMNYVIGTHGWLPYDRNISNYFTFIKDQTVTNPKTQRSINGSFAPGLEIT
SKLFVVSHDAKLLFSAGYWDNSIQVMSLTKGKIISHIIRHMDIVTCLATDYCGIHLISGS
RDTTCMIWQITQQGGVPVGLASKPFQILYGHTNEVLSVGISTELDMAVSGSRDGTVIIHT
IQKGQYMRTLRPPCESSLFLTIPNLAISWEGHIVVYSSTEEKTTLKDKNALHLFSINGKY
LGSQILKEQVSDICIIGEHIVTGSIQGFLSIRDLHSLNLSINPLAMRLPIHCVCVTKEYS
HILVGLEDGKLIVVGVGKPAEMRSGQLSRKFWGSSKRLSQISAGETEYNTQDSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5nnzA	0.097	0.671	2.942E-10	335	0.022	0.176	5nnzA.pdb.gz
2	PDB:3zwlD	0.101	0.685	3.533E-10	352	0.017	0.134	3zwlD.pdb.gz
3	PDB:5o9zL	0.100	0.519	4.400E-10	459	0.026	0.153	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
4	PDB:5mzhB	0.094	0.525	4.564E-10	415	0.023	0.152	5mzhB.pdb.gz
5	PDB:3dm0A	0.099	0.369	5.897E-10	675	0.023	0.092	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
6	PDB:2h9lA	0.099	0.721	9.845E-10	321	0.025	0.212	2h9lA.pdb.gz
7	PDB:7mq8LJ	0.100	0.519	1.527E-9	469	0.022	0.126	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:5a2qg	0.099	0.742	2.458E-9	314	0.022	0.191	5a2qg.pdb.gz	Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
9	PDB:7pzyh	0.101	0.764	2.550E-9	311	0.021	0.183	7pzyh.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
10	PDB:6bk8M	0.094	0.659	2.645E-9	326	0.019	0.153	6bk8M.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
11	AFDB:Q389F7	0.094	0.213	5.082E-8	1105	0.021	0.051	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1
12	AFDB:Q9VC96	0.103	0.123	1.469E-7	2232	0.026	0.032	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
13	AFDB:Q8VDD9	0.102	0.146	1.227E-6	1821	0.029	0.043	Q8VDD9.pdb.gz	PHIP_MOUSE PH-interacting protein OS=Mus musculus OX=10090 GN=Phip PE=1 SV=2
14	AFDB:O60336	0.101	0.173	1.273E-6	1514	0.023	0.042	O60336.pdb.gz	MABP1_HUMAN Mitogen-activated protein kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=MAPKBP1 PE=1 SV=4
15	AFDB:Q8H0T9	0.094	0.278	1.706E-6	837	0.019	0.062	Q8H0T9.pdb.gz	KTN84_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4 OS=Arabidopsis thaliana OX=3702 GN=KTN80.4 PE=1 SV=3
16	AFDB:F4KB17	0.098	0.293	3.297E-6	839	0.020	0.066	F4KB17.pdb.gz	KTN83_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3 OS=Arabidopsis thaliana OX=3702 GN=KTN80.3 PE=1 SV=1
17	AFDB:P25365	0.101	0.243	5.923E-6	1065	0.013	0.032	P25365.pdb.gz	SED4_YEAST Putative guanine nucleotide-exchange factor SED4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SED4 PE=1 SV=1
18	AFDB:P33215	0.081	0.301	5.923E-6	660	0.017	0.071	P33215.pdb.gz	NEDD1_MOUSE Protein NEDD1 OS=Mus musculus OX=10090 GN=Nedd1 PE=1 SV=2
19	AFDB:Q96UP3	0.151	0.237	5.923E-6	1400	0.059	0.113	Q96UP3.pdb.gz	RIF1_SCHPO Telomere length regulator protein rif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rif1 PE=1 SV=1
20	AFDB:Q57TT4	0.100	0.175	6.856E-6	1450	0.019	0.035	Q57TT4.pdb.gz	Q57TT4_TRYB2 Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.700 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7FAW3	0.0	2487	2801	0.497	0.478	NBEL2_DANRE Neurobeachin-like protein 2 OS=Danio rerio OX=7955 GN=nbeal2 PE=1 SV=1
2	Q6ZNJ1	0.0	1440	2754	0.269	0.264	NBEL2_HUMAN Neurobeachin-like protein 2 OS=Homo sapiens OX=9606 GN=NBEAL2 PE=1 SV=2
3	Q6ZQA0	0.0	2355	2742	0.477	0.469	NBEL2_MOUSE Neurobeachin-like protein 2 OS=Mus musculus OX=10090 GN=Nbeal2 PE=1 SV=2
4	Q9ESE1	1.12e-141	500	2856	0.135	0.128	LRBA_MOUSE Lipopolysaccharide-responsive and beige-like anchor protein OS=Mus musculus OX=10090 GN=Lrba PE=1 SV=1
5	P50851	2.42e-141	499	2863	0.138	0.130	LRBA_HUMAN Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA PE=1 SV=4
6	Q9EPN1	4.16e-141	498	2936	0.120	0.110	NBEA_MOUSE Neurobeachin OS=Mus musculus OX=10090 GN=Nbea PE=1 SV=1
7	Q9W4E2	2.58e-137	486	3466	0.122	0.095	NBEA_DROME Neurobeachin OS=Drosophila melanogaster OX=7227 GN=rg PE=1 SV=4
8	F4I9T0	1.72e-134	476	2604	0.105	0.109	BCHB_ARATH BEACH domain-containing protein B OS=Arabidopsis thaliana OX=3702 GN=BCHB PE=4 SV=1
9	E7EZD1	1.36e-133	474	2998	0.115	0.103	E7EZD1_DANRE Neurobeachin OS=Danio rerio OX=7955 GN=im:7138260 PE=1 SV=2
10	Q19317	2.49e-121	433	2507	0.109	0.117	NBEA_CAEEL Putative neurobeachin homolog OS=Caenorhabditis elegans OX=6239 GN=sel-2 PE=2 SV=3
11	Q54RQ8	1.24e-116	417	2192	0.106	0.130	LVSE_DICDI BEACH domain-containing protein lvsE OS=Dictyostelium discoideum OX=44689 GN=lvsE PE=4 SV=1
12	Q8IZQ1	7.71e-113	407	3526	0.095	0.072	WDFY3_HUMAN WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens OX=9606 GN=WDFY3 PE=1 SV=2
13	Q6VNB8	1.09e-112	406	3508	0.095	0.073	WDFY3_MOUSE WD repeat and FYVE domain-containing protein 3 OS=Mus musculus OX=10090 GN=Wdfy3 PE=1 SV=1
14	Q9VML2	2.93e-108	392	3489	0.101	0.078	Q9VML2_DROME Blue cheese OS=Drosophila melanogaster OX=7227 GN=bchs PE=4 SV=4
15	Q55DM1	9.31e-104	377	3619	0.086	0.064	LVSA_DICDI BEACH domain-containing protein lvsA OS=Dictyostelium discoideum OX=44689 GN=lvsA PE=4 SV=2
16	F4JHT3	2.85e-100	365	3527	0.082	0.063	BCHA2_ARATH BEACH domain-containing protein A2 OS=Arabidopsis thaliana OX=3702 GN=BCHA2 PE=4 SV=1
17	F4HZB2	7.60e-100	364	3601	0.081	0.060	BCHA1_ARATH Protein SPIRRIG OS=Arabidopsis thaliana OX=3702 GN=SPI PE=1 SV=1
18	Q55AV3	1.73e-97	356	2967	0.097	0.088	LVSD_DICDI BEACH domain-containing protein lvsD OS=Dictyostelium discoideum OX=44689 GN=lvsD PE=4 SV=2
19	Q92636	7.82e-97	338	917	0.096	0.282	FAN_HUMAN Protein FAN OS=Homo sapiens OX=9606 GN=NSMAF PE=1 SV=2
20	O35242	2.69e-93	328	920	0.095	0.278	FAN_MOUSE Protein FAN OS=Mus musculus OX=10090 GN=Nsmaf PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02138 Beach	2.3e-116	399.6	Beige/BEACH domain
2	PF15787 DUF4704	3.4e-29	113.6	Neurobeachin/BDCP, DUF4704 alpha solenoid region
3	PF16057 DUF4800	3e-124	424.8	Domain of unknown function (DUF4800)
4	PF02893 GRAM	2.4e+02	13.0	GRAM domain
5	PF13385 Laminin_G_3	14	17.2	Concanavalin A-like lectin/glucanases superfamily
6	PF20426 NBCH_WD40	6.7e-42	155.2	Neurobeachin beta propeller domain
7	PF14844 PH_BEACH	3.6e-18	76.9	PH domain associated with Beige/BEACH
8	PF00400 WD40	3.7e-05	35.6	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399903

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355979	0.745	SERTA domain containing 4
2	9606.ENSP00000380861	0.745	Zinc finger and BTB domain-containing protein 44
3	9606.ENSP00000384006	0.641	Calcium-responsive transcription factor
4	9606.ENSP00000478645	0.605	Islet cell autoantigen 1-like protein
5	9606.ENSP00000308275	0.560	Mitochondrial ribosomal protein L38
6	9606.ENSP00000263708	0.531	Tyrosine-protein phosphatase non-receptor type 4
7	9606.ENSP00000261015	0.527	Ribosome biogenesis protein WDR12
8	9606.ENSP00000376071	0.523	Protein FAM117B
9	9606.ENSP00000269383	0.501	Tripartite motif containing 65

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0048856	0.863	anatomical structure development
GO:0065007	0.845	biological regulation
GO:0050789	0.817	regulation of biological process
GO:0048468	0.718	cell development
GO:0050794	0.647	regulation of cellular process
GO:0071840	0.522	cellular component organization or biogenesis
GO:0044237	0.480	cellular metabolic process
GO:0050896	0.411	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0016020	0.993	membrane
GO:0043233	0.946	organelle lumen
GO:0070013	0.943	intracellular organelle lumen
GO:0005634	0.913	nucleus
GO:0012505	0.872	endomembrane system
GO:0031981	0.852	nuclear lumen
GO:0005886	0.841	plasma membrane
GO:0005829	0.836	cytosol
GO:0031090	0.631	organelle membrane
GO:0043232	0.567	intracellular non-membrane-bounded organelle
GO:0031982	0.462	vesicle
GO:0005730	0.348	nucleolus
GO:0005654	0.345	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]