StarFunc result for job id Q6ZS81

User Input

>input (1400 residues)
MEAEDLSKAEDRNEDPGSKNEGQLAAVQPDVPHGGQSSSPTALWDMLERKFLEYQQLTHK
SPIERQKSLLSLLPLFLKAWEHSVGIICFPSLQRLAEDVSDQLAQQLQKALVGKPAEQAR
LAAGQLLWWKGDVDQDGYLLLKSVYVLTGTDSETLGRVAESGLPALLLQCLYLFFVFPLD
KDELLESDLQVQKMFVQMLLNICSDSQGLEGLLSGSELQSLLIATTCLREHSCCFWKEPT
FCVLRAISKAQNLSIIQYLQATDCVRLSLQNLSRLTDTLPAPEVSEAVSLILGFVKDSYP
VSSALFLEFENSEGYPLLLKVLLRYDGLTQSEVDPHLEELLGLVVWLTTCGRSELKVFDS
ITYPQLEGFKFHHEASGVTVKNLQAFQVLQNVFHKASDSVLCIQVLSVIRTMWAWNARNF
FLLEWTLQPISQFVEIMPLKPAPVQEHFFQLLEALVFELHYVPHEILRKVQHLIKESPGP
SCTLMALQSILSIAGGDPLFTDIFRDSGLLGLLLAQLRKQAKIMRKSGNKVSTPGVQDPE
RELTCVMLRIVVTLLKGSVRNAVVLKDHGMVPFIKIFLDDECYREASLSILEQLSAINAE
EYMSIIVGALCSSTQGELQLKLDLLKSLLRILVTPKGRAAFRVSSGFNGLLSLLSDLEGS
LQEPPLQAWGAVSPRQTLELVLYTLCAVSAALHWDPVNGYFFRRNGLFEKLAEDLCLLGC
FGALEEEGNLLRSWVDTKARPFADLLGTAFSSSGSLPPRIQSCLQILGFLDSMASGTLHL
RGDLKESLRTKQGPVVDVQKGETGSDPQRNFKQWPDLEERMDEGDAAIMHPGVVCIMVRL
LPRLYHEDHPQLSEEIQCSLASHIQSLVKSEKNRQVMCEAGLLGTLMASCHRALVTSGSP
LHSRLIRIFEKLASQAIEPDVLRQFLGLGIPSSLSATTKILDSSHTHRGNPGCSGSQTAQ
GLAEGPWPAAPDAGLHPGVTQAPQPLGESQDSTTALQTALSLISMTSPRNLQPQRAALAP
SFVEFDMSVEGYGCLFIPTLSTVMGTSTEYSVSGGIGTGATRPFPPPGGLTFSCWFLISR
HGAATEGHPLRFLTLVRHLARTEQPFVCFSVSLCPDDLSLVVSTEEKEFQPLDVMEPEDD
SEPSAGCQLQVRCGQLLACGQWHHLAVVVTKEMKRHCTVSTCLDGQVIGSAKMLYIQALP
GPFLSMDPSAFVDVYGYIATPRVWKQKSSLIWRLGPTYLFEEAISMETLEVINKLGPRYC
GNFQAVHVQGEDLDSEATPFVAEERVSFGLHIASSSITSVADIRNAYNEVDSRLIAKEMN
ISSRDNAMPVFLLRNCAGHLSGSLRTIGAVAVGQLGVRVFHSSPAASSLDFIGGPAILLG
LISLATDDHTMYAAVKVLHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F4I9T0	0.363	0.209	3.413E-15	2604	0.092	0.050	F4I9T0.pdb.gz	BCHB_ARATH BEACH domain-containing protein B OS=Arabidopsis thaliana OX=3702 GN=BCHB PE=4 SV=1
2	AFDB:E9QCE1	0.242	0.504	8.131E-12	607	0.073	0.168	E9QCE1.pdb.gz
3	AFDB:Q8MRY5	0.187	0.656	8.256E-10	381	0.056	0.207	Q8MRY5.pdb.gz	Q8MRY5_DROME SD12984p OS=Drosophila melanogaster OX=7227 GN=bchs PE=2 SV=1
4	AFDB:A0A2R8Y5A3	0.130	0.210	4.106E-8	783	0.084	0.149	A0A2R8Y5A3.pdb.gz	A0A2R8Y5A3_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
5	AFDB:Q8H0U3	0.135	0.194	5.545E-8	834	0.083	0.139	Q8H0U3.pdb.gz	Q8H0U3_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g23180 PE=1 SV=1
6	AFDB:P18824	0.135	0.201	6.207E-8	843	0.084	0.140	P18824.pdb.gz	ARM_DROME Armadillo segment polarity protein OS=Drosophila melanogaster OX=7227 GN=arm PE=1 SV=1
7	PDB:2z6gA	0.148	0.306	1.761E-7	550	0.056	0.142	2z6gA.pdb.gz
8	AFDB:B2RY50	0.125	0.160	2.686E-7	1037	0.078	0.105	B2RY50.pdb.gz	ODAD2_MOUSE Outer dynein arm-docking complex subunit 2 OS=Mus musculus OX=10090 GN=Odad2 PE=1 SV=1
9	PDB:1qgkA	0.168	0.247	4.023E-7	876	0.084	0.134	1qgkA.pdb.gz
10	AFDB:P14923	0.132	0.213	4.060E-7	745	0.081	0.153	P14923.pdb.gz	PLAK_HUMAN Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3
11	AFDB:Q5UIP0	0.121	0.091	7.689E-7	2472	0.105	0.059	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
12	PDB:4a0cA	0.152	0.174	1.029E-6	1155	0.096	0.117	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
13	PDB:4r0zA	0.144	0.286	1.196E-6	557	0.065	0.163	4r0zA.pdb.gz
14	AFDB:P52297	0.174	0.258	1.207E-6	876	0.074	0.119	P52297.pdb.gz	IMB_XENLA Importin subunit beta OS=Xenopus laevis OX=8355 GN=kpnb1 PE=1 SV=3
15	PDB:2xwuB	0.193	0.255	2.023E-6	910	0.086	0.133	2xwuB.pdb.gz
16	PDB:3w3uA	0.162	0.203	3.297E-6	1030	0.076	0.103	3w3uA.pdb.gz
17	PDB:7ay1A	0.155	0.196	4.984E-6	1033	0.084	0.113	7ay1A.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
18	PDB:7qenD	0.147	0.177	5.175E-6	1050	0.082	0.110	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
19	PDB:7rroH7	0.141	0.278	5.175E-6	580	0.057	0.138	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:4c0qA	0.167	0.231	5.373E-6	871	0.086	0.139	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q2M9	0.0	2191	3183	0.805	0.354	WDFY4_MOUSE WD repeat- and FYVE domain-containing protein 4 OS=Mus musculus OX=10090 GN=Wdfy4 PE=1 SV=2
2	Q6VNB8	0.0	716	3508	0.341	0.136	WDFY3_MOUSE WD repeat and FYVE domain-containing protein 3 OS=Mus musculus OX=10090 GN=Wdfy3 PE=1 SV=1
3	Q6ZS81	0.0	2855	3184	1.000	0.440	WDFY4_HUMAN WD repeat- and FYVE domain-containing protein 4 OS=Homo sapiens OX=9606 GN=WDFY4 PE=1 SV=3
4	Q8IZQ1	0.0	708	3526	0.336	0.133	WDFY3_HUMAN WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens OX=9606 GN=WDFY3 PE=1 SV=2
5	Q9VML2	2.52e-155	524	3489	0.308	0.124	Q9VML2_DROME Blue cheese OS=Drosophila melanogaster OX=7227 GN=bchs PE=4 SV=4
6	Q8MRY5	9.60e-16	83.2	381	0.064	0.236	Q8MRY5_DROME SD12984p OS=Drosophila melanogaster OX=7227 GN=bchs PE=2 SV=1
7	Q55DM1	2.59e-15	84.7	3619	0.081	0.031	LVSA_DICDI BEACH domain-containing protein lvsA OS=Dictyostelium discoideum OX=44689 GN=lvsA PE=4 SV=2
8	F4HZB2	4.90e-07	57.4	3601	0.046	0.018	BCHA1_ARATH Protein SPIRRIG OS=Arabidopsis thaliana OX=3702 GN=SPI PE=1 SV=1
9	F4JHT3	9.40e-05	49.7	3527	0.050	0.020	BCHA2_ARATH BEACH domain-containing protein A2 OS=Arabidopsis thaliana OX=3702 GN=BCHA2 PE=4 SV=1
10	Q9W4E2	0.85	36.6	3466	0.016	0.007	NBEA_DROME Neurobeachin OS=Drosophila melanogaster OX=7227 GN=rg PE=1 SV=4
11	P38850	1.4	35.8	1070	0.016	0.021	RT107_YEAST Regulator of Ty1 transposition protein 107 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTT107 PE=1 SV=1
12	F4I9T0	4.2	34.3	2604	0.019	0.010	BCHB_ARATH BEACH domain-containing protein B OS=Arabidopsis thaliana OX=3702 GN=BCHB PE=4 SV=1
13	Q387Z3	4.7	33.9	366	0.017	0.066	Q387Z3_TRYB2 Nucleosome assembly protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1330 PE=3 SV=1
14	P26952	5.2	33.9	396	0.014	0.051	IL3RA_MOUSE Interleukin-3 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il3ra PE=1 SV=1
15	Q8R0F3	6.5	33.5	372	0.012	0.046	SUMF1_MOUSE Formylglycine-generating enzyme OS=Mus musculus OX=10090 GN=Sumf1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13764 E3_UbLigase_R4	5.1e+02	10.1	E3 ubiquitin-protein ligase UBR4
2	PF13385 Laminin_G_3	3.2e+02	12.8	Concanavalin A-like lectin/glucanases superfamily
3	PF08167 RIX1	81	14.4	rRNA processing/ribosome biogenesis

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320563

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331614	0.753	DNA-binding protein Ikaros
2	9606.ENSP00000298124	0.745	Leucine-rich repeat-containing protein 18
3	9606.ENSP00000323435	0.740	Sorting nexin-22
4	9606.ENSP00000354335	0.740	Macrophage-expressed gene 1 protein
5	9606.ENSP00000377801	0.739	RCC1 domain-containing protein 1
6	9606.ENSP00000399078	0.738	Olfactory receptor 10J1
7	9606.ENSP00000367658	0.732	Actin related protein T2
8	9606.ENSP00000234313	0.719	Pleckstrin
9	9606.ENSP00000305721	0.712	Inhibitor of Bruton tyrosine kinase
10	9606.ENSP00000248901	0.708	Cytohesin-4
11	9606.ENSP00000352833	0.687	Tyrosine-protein phosphatase non-receptor type 22
12	9606.ENSP00000384053	0.685	Cytokine receptor common subunit beta
13	9606.ENSP00000298125	0.680	WD repeat and FYVE domain-containing protein 2
14	9606.ENSP00000353010	0.673	Autophagy-related protein 2 homolog B
15	9606.ENSP00000366475	0.673	Autophagy-related protein 2 homolog A
16	9606.ENSP00000268638	0.670	Interferon regulatory factor 8
17	9606.ENSP00000380948	0.668	Integrin beta-2
18	9606.ENSP00000227163	0.663	Transcription factor PU.1
19	9606.ENSP00000373696	0.662	E3 ubiquitin-protein ligase TRIP12
20	9606.ENSP00000411355	0.660	Receptor-type tyrosine-protein phosphatase C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0001775	0.972	cell activation
GO:0002376	0.970	immune system process
GO:0046649	0.945	lymphocyte activation
GO:0042110	0.939	T cell activation
GO:0050896	0.931	response to stimulus
GO:0009615	0.918	response to virus
GO:0046631	0.913	alpha-beta T cell activation
GO:0019882	0.849	antigen processing and presentation
GO:0098586	0.778	cellular response to virus
GO:0065007	0.317	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043227	0.996	membrane-bounded organelle
GO:0043229	0.996	intracellular organelle
GO:0043231	0.987	intracellular membrane-bounded organelle
GO:0005829	0.972	cytosol
GO:0016020	0.934	membrane
GO:0070013	0.906	intracellular organelle lumen
GO:0005654	0.886	nucleoplasm
GO:0005886	0.830	plasma membrane
GO:0043232	0.829	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]