StarFunc result for job id Q6ZSA7

User Input

>input (298 residues)
MGDTWAQLPWPGPPHPAMLLISLLLAAGLMHSDAGTSCPVLCTCRNQVVDCSSQRLFSVP
PDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVLDLHNNSLMELPRGLFLHAKRLAHLDL
SYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLE
ALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAPLFS
LTEESFKACHLTLTLDDYLFIAFVGFVVSIASVATNFLLGITANCCHRWSKASEEEEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZSA7	1.000	1.000	3.382E-50	298	1.000	1.000	Q6ZSA7.pdb.gz	LRC55_HUMAN Leucine-rich repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=LRRC55 PE=1 SV=3
2	AFDB:Q5VT99	0.762	0.771	6.665E-18	294	0.342	0.347	Q5VT99.pdb.gz	LRC38_HUMAN Leucine-rich repeat-containing protein 38 OS=Homo sapiens OX=9606 GN=LRRC38 PE=1 SV=1
3	AFDB:Q5M8M9	0.815	0.775	2.363E-17	314	0.299	0.283	Q5M8M9.pdb.gz	LRC52_MOUSE Leucine-rich repeat-containing protein 52 OS=Mus musculus OX=10090 GN=Lrrc52 PE=1 SV=1
4	AFDB:Q8N7C0	0.804	0.768	6.437E-17	313	0.315	0.300	Q8N7C0.pdb.gz	LRC52_HUMAN Leucine-rich repeat-containing protein 52 OS=Homo sapiens OX=9606 GN=LRRC52 PE=1 SV=2
5	AFDB:Q2I0M4	0.685	0.614	1.053E-15	334	0.295	0.263	Q2I0M4.pdb.gz	LRC26_HUMAN Leucine-rich repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=LRRC26 PE=1 SV=2
6	AFDB:Q6WRI0	0.604	0.078	6.793E-14	2623	0.215	0.024	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
7	AFDB:Q9Z0L0	0.436	0.334	1.036E-13	426	0.282	0.197	Q9Z0L0.pdb.gz	TPBG_MOUSE Trophoblast glycoprotein OS=Mus musculus OX=10090 GN=Tpbg PE=1 SV=3
8	AFDB:F1QA76	0.504	0.337	1.092E-13	457	0.268	0.175	F1QA76.pdb.gz
9	AFDB:P24014	0.610	0.133	1.279E-13	1504	0.238	0.047	P24014.pdb.gz	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2
10	AFDB:Q9NT99	0.310	0.161	1.279E-13	713	0.242	0.101	Q9NT99.pdb.gz	LRC4B_HUMAN Leucine-rich repeat-containing protein 4B OS=Homo sapiens OX=9606 GN=LRRC4B PE=2 SV=3
11	PDB:5y31B	0.470	0.295	1.949E-8	511	0.171	0.100	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
12	PDB:7wv3A	0.526	0.244	8.997E-8	668	0.154	0.069	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
13	PDB:1xcdA	0.516	0.504	1.446E-7	305	0.164	0.161	1xcdA.pdb.gz
14	PDB:6gffI	0.416	0.237	1.694E-7	551	0.171	0.093	6gffI.pdb.gz
15	PDB:3t6qA	0.359	0.205	2.367E-6	601	0.178	0.088	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:5yq5B	0.475	0.463	3.424E-6	306	0.161	0.157	5yq5B.pdb.gz
17	PDB:7wrqA	0.302	0.181	7.552E-6	566	0.225	0.118	7wrqA.pdb.gz
18	PDB:3b2dA	0.390	0.222	8.846E-6	601	0.161	0.080	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
19	PDB:2ft3F	0.302	0.295	1.214E-5	305	0.164	0.161	2ft3F.pdb.gz
20	PDB:6hkwA	0.322	0.315	3.674E-5	306	0.141	0.137	6hkwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZSA7	0.0	612	298	1.000	1.000	LRC55_HUMAN Leucine-rich repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=LRRC55 PE=1 SV=3
2	Q5VT99	2.85e-43	151	294	0.322	0.327	LRC38_HUMAN Leucine-rich repeat-containing protein 38 OS=Homo sapiens OX=9606 GN=LRRC38 PE=1 SV=1
3	Q8N7C0	1.09e-38	140	313	0.319	0.304	LRC52_HUMAN Leucine-rich repeat-containing protein 52 OS=Homo sapiens OX=9606 GN=LRRC52 PE=1 SV=2
4	Q5M8M9	8.92e-38	137	314	0.299	0.283	LRC52_MOUSE Leucine-rich repeat-containing protein 52 OS=Mus musculus OX=10090 GN=Lrrc52 PE=1 SV=1
5	Q2I0M4	3.78e-28	112	334	0.285	0.254	LRC26_HUMAN Leucine-rich repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=LRRC26 PE=1 SV=2
6	Q8BGX3	3.26e-22	97.1	370	0.272	0.219	LRTM2_MOUSE Leucine-rich repeat and transmembrane domain-containing protein 2 OS=Mus musculus OX=10090 GN=Lrtm2 PE=2 SV=1
7	Q80TR4	3.83e-22	99.0	1531	0.262	0.051	SLIT1_MOUSE Slit homolog 1 protein OS=Mus musculus OX=10090 GN=Slit1 PE=1 SV=2
8	Q9DE36	6.98e-22	98.2	1512	0.225	0.044	Q9DE36_DANRE Slit homolog 2 protein precursor OS=Danio rerio OX=7955 GN=slit2 PE=1 SV=1
9	O75093	7.69e-22	97.8	1534	0.205	0.040	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
10	Q9WVC1	1.27e-21	97.1	766	0.201	0.078	SLIT2_RAT Slit homolog 2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Slit2 PE=1 SV=3
11	O88279	1.42e-21	97.1	1531	0.235	0.046	SLIT1_RAT Slit homolog 1 protein OS=Rattus norvegicus OX=10116 GN=Slit1 PE=1 SV=1
12	Q3Y6S4	1.99e-21	96.7	1532	0.238	0.046	Q3Y6S4_DANRE Slit homolog 1b precursor OS=Danio rerio OX=7955 GN=slit1b PE=2 SV=1
13	Q3S2J2	2.81e-21	96.3	1524	0.215	0.042	Q3S2J2_DANRE Slit homolog 1 protein precursor OS=Danio rerio OX=7955 GN=slit1a PE=1 SV=1
14	A0A0R4IU60	3.59e-21	95.9	1531	0.238	0.046	A0A0R4IU60_DANRE Slit homolog 1b (Drosophila) OS=Danio rerio OX=7955 GN=slit1b PE=4 SV=1
15	O94813	6.07e-21	95.5	1529	0.235	0.046	SLIT2_HUMAN Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1
16	Q9R1B9	8.43e-21	94.7	1521	0.201	0.039	SLIT2_MOUSE Slit homolog 2 protein OS=Mus musculus OX=10090 GN=Slit2 PE=2 SV=2
17	G5EFX6	1.34e-20	94.4	1410	0.215	0.045	SLIT1_CAEEL Slit homolog 1 protein OS=Caenorhabditis elegans OX=6239 GN=slt-1 PE=1 SV=1
18	P24014	2.11e-20	93.6	1504	0.225	0.045	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2
19	D2XV92	3.02e-20	93.2	1513	0.201	0.040	D2XV92_CHICK SLIT1 (Fragment) OS=Gallus gallus OX=9031 GN=SLIT1 PE=2 SV=1
20	Q86UN3	1.26e-19	90.5	420	0.275	0.195	R4RL2_HUMAN Reticulon-4 receptor-like 2 OS=Homo sapiens OX=9606 GN=RTN4RL2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01463 LRRCT	30	16.5	Leucine rich repeat C-terminal domain
2	PF01462 LRRNT	0.067	24.1	Leucine rich repeat N-terminal domain
3	PF00560 LRR_1	0.00074	30.5	Leucine Rich Repeat
4	PF12799 LRR_4	4.2e-07	41.4	Leucine Rich repeats (2 copies)
5	PF13516 LRR_6	3.9e+02	12.6	Leucine Rich repeat
6	PF13855 LRR_8	1.7e-21	87.0	Leucine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419542

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382770	0.763	Potassium channel subfamily U member 1
2	9606.ENSP00000268720	0.670	Copine-7
3	9606.ENSP00000361663	0.651	Interleukin 1 receptor accessory protein like 2
4	9606.ENSP00000436585	0.642	Ethylmalonyl-CoA decarboxylase
5	9606.ENSP00000258111	0.637	Calcium-activated potassium channel subunit beta-4
6	9606.ENSP00000274629	0.616	Calcium-activated potassium channel subunit beta-1
7	9606.ENSP00000286628	0.616	Calcium-activated potassium channel subunit alpha-1
8	9606.ENSP00000319370	0.576	Calcium-activated potassium channel subunit beta-3
9	9606.ENSP00000365351	0.560	Integrin subunit beta like 1
10	9606.ENSP00000355752	0.532	Protein stum homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005267	1.000	potassium channel activity
GO:0015459	0.999	potassium channel regulator activity
GO:0005244	0.999	voltage-gated monoatomic ion channel activity
GO:0044325	0.996	transmembrane transporter binding
GO:0099103	0.996	channel activator activity
GO:0005249	0.994	voltage-gated potassium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.996	biological regulation
GO:0050794	0.989	regulation of cellular process
GO:0051234	0.982	establishment of localization
GO:0048518	0.982	positive regulation of biological process
GO:1904062	0.976	regulation of monoatomic cation transmembrane transport
GO:0098660	0.974	inorganic ion transmembrane transport
GO:1901379	0.974	regulation of potassium ion transmembrane transport
GO:0006813	0.969	potassium ion transport
GO:0048522	0.928	positive regulation of cellular process
GO:0032412	0.919	regulation of monoatomic ion transmembrane transporter activity
GO:0043268	0.909	positive regulation of potassium ion transport
GO:1901016	0.909	regulation of potassium ion transmembrane transporter activity
GO:1904064	0.906	positive regulation of cation transmembrane transport
GO:1901381	0.889	positive regulation of potassium ion transmembrane transport
GO:0032414	0.878	positive regulation of ion transmembrane transporter activity
GO:0098662	0.874	inorganic cation transmembrane transport
GO:2001257	0.856	regulation of cation channel activity
GO:1901018	0.855	positive regulation of potassium ion transmembrane transporter activity
GO:0071805	0.723	potassium ion transmembrane transport
GO:2001259	0.361	positive regulation of cation channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0098797	0.989	plasma membrane protein complex
GO:0034702	0.966	ion channel complex
GO:0008076	0.957	voltage-gated potassium channel complex
GO:0005622	0.413	intracellular anatomical structure
GO:0043226	0.309	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]