StarFunc result for job id Q6ZSG1

User Input

>input (346 residues)
MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAPDFPLAHPVQS
QPGLSAHMAPAHQHSGALHQSLTPLPTLQFQDVTGPSFLPQALHQQYLLQQQLLEAQHRR
LVSHPRRSQERVSVHPHRLHPSFDFGQLQTPQPRYLAEGTDWDLSVDAGLSPAQFQVRPI
PQHYQHYLATPRMHHFPRNSSSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYE
ELLQLEDRLGNVTRGAVQNTIERFTFPHKYKKRRPQDGKGKKDEGEESDTDEKCTICLSM
LEDGEDVRRLPCMHLFHQLCVDQWLAMSKKCPICRVDIETQLGADS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9QAU8	0.458	0.457	2.779E-54	347	0.988	0.986	E9QAU8.pdb.gz	ARK2C_MOUSE E3 ubiquitin-protein ligase ARK2C OS=Mus musculus OX=10090 GN=Ark2c PE=1 SV=1
2	AFDB:D4A9T1	0.308	0.118	3.308E-21	987	0.428	0.150	D4A9T1.pdb.gz	D4A9T1_RAT Ring finger protein 111 OS=Rattus norvegicus OX=10116 GN=Rnf111 PE=3 SV=2
3	AFDB:R4KWC4	0.249	0.092	4.638E-19	1032	0.448	0.150	R4KWC4.pdb.gz	R4KWC4_DANRE E3 ubiquitin-protein ligase Arkadia OS=Danio rerio OX=7955 GN=rnf111 PE=2 SV=1
4	AFDB:Q5XEP8	0.252	0.174	4.451E-10	525	0.214	0.141	Q5XEP8.pdb.gz	Q5XEP8_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=JUL1 PE=1 SV=1
5	AFDB:Q7XTV7	0.249	0.138	2.679E-8	667	0.211	0.109	Q7XTV7.pdb.gz	HIP1_ORYSJ Probable E3 ubiquitin-protein ligase HIP1 OS=Oryza sativa subsp. japonica OX=39947 GN=HIP1 PE=1 SV=2
6	AFDB:O49500	0.233	0.126	6.658E-8	666	0.179	0.093	O49500.pdb.gz	MBR2_ARATH E3 ubiquitin-protein ligase MBR2 OS=Arabidopsis thaliana OX=3702 GN=MBR2 PE=1 SV=1
7	AFDB:Q94F54	0.250	0.185	1.196E-7	486	0.179	0.128	Q94F54.pdb.gz	Q94F54_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=TEAR2 PE=2 SV=1
8	AFDB:Q63364	0.200	0.107	1.091E-6	707	0.165	0.081	Q63364.pdb.gz	PJA2_RAT E3 ubiquitin-protein ligase Praja-2 OS=Rattus norvegicus OX=10116 GN=Pja2 PE=2 SV=1
9	AFDB:Q557I6	0.163	0.108	4.994E-2	552	0.171	0.107	Q557I6.pdb.gz	Q557I6_DICDI RING-type E3 ubiquitin transferase OS=Dictyostelium discoideum OX=44689 GN=mip1-2 PE=4 SV=1
10	AFDB:A0A1I6CMA8	0.099	0.110	2.089E-1	291	0.107	0.127	A0A1I6CMA8.pdb.gz	A0A1I6CMA8_CAEEL BZIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=zip-9 PE=1 SV=1
11	PDB:2lgvA	0.120	0.395	3.063E-1	100	0.052	0.180	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
12	PDB:5l9uB	0.124	0.548	3.488E-1	71	0.055	0.268	5l9uB.pdb.gz
13	PDB:7oniR	0.128	0.485	3.488E-1	86	0.049	0.198	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
14	PDB:4a0cF	0.114	0.466	7.613E-1	80	0.040	0.175	4a0cF.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
15	PDB:4r8pL	0.117	0.159	9.874E-1	254	0.046	0.063	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
16	PDB:5gm6a	0.117	0.316	1.125	123	0.040	0.114	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:8a3tU	0.112	0.325	1.200	114	0.043	0.132	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
18	PDB:7uhyD	0.104	0.123	1.367	288	0.035	0.042	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:7oikA	0.118	0.010	3.184	4426	0.046	0.004	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
20	PDB:7mfdA	0.073	0.062	3.626	410	0.026	0.022	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QAU8	0.0	698	347	0.988	0.986	ARK2C_MOUSE E3 ubiquitin-protein ligase ARK2C OS=Mus musculus OX=10090 GN=Ark2c PE=1 SV=1
2	Q6ZSG1	0.0	709	346	1.000	1.000	ARK2C_HUMAN E3 ubiquitin-protein ligase ARK2C OS=Homo sapiens OX=9606 GN=ARK2C PE=1 SV=1
3	D4A9T1	5.88e-57	201	1011	0.425	0.145	D4A9T1_RAT Ring finger protein 111 OS=Rattus norvegicus OX=10116 GN=Rnf111 PE=3 SV=2
4	Q99ML9	4.39e-55	196	989	0.384	0.134	RN111_MOUSE E3 ubiquitin-protein ligase Arkadia OS=Mus musculus OX=10090 GN=Rnf111 PE=1 SV=1
5	Q6ZNA4	5.88e-54	192	994	0.387	0.135	RN111_HUMAN E3 ubiquitin-protein ligase Arkadia OS=Homo sapiens OX=9606 GN=RNF111 PE=1 SV=3
6	F1QWE1	1.00e-51	186	1004	0.405	0.139	F1QWE1_DANRE E3 ubiquitin-protein ligase Arkadia isoform X3 OS=Danio rerio OX=7955 GN=rnf111 PE=3 SV=2
7	N0A274	1.03e-51	186	1003	0.405	0.140	N0A274_DANRE E3 ubiquitin-protein ligase Arkadia isoform X4 OS=Danio rerio OX=7955 GN=rnf111 PE=2 SV=1
8	R4KWC4	6.04e-48	175	1032	0.405	0.136	R4KWC4_DANRE E3 ubiquitin-protein ligase Arkadia OS=Danio rerio OX=7955 GN=rnf111 PE=2 SV=1
9	Q7XTV7	1.98e-14	76.6	667	0.110	0.057	HIP1_ORYSJ Probable E3 ubiquitin-protein ligase HIP1 OS=Oryza sativa subsp. japonica OX=39947 GN=HIP1 PE=1 SV=2
10	Q5XEP8	3.47e-13	72.4	525	0.107	0.070	Q5XEP8_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=JUL1 PE=1 SV=1
11	Q9VHC2	1.82e-12	70.9	1173	0.124	0.037	Q9VHC2_DROME GH10160p OS=Drosophila melanogaster OX=7227 GN=mura PE=2 SV=4
12	Q8R4E3	2.59e-12	69.7	432	0.104	0.083	Q8R4E3_RAT RING finger protein OIP1 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=2 SV=1
13	Q8SX72	3.76e-12	69.7	868	0.124	0.050	Q8SX72_DROME LD30050p OS=Drosophila melanogaster OX=7227 GN=mura PE=2 SV=1
14	O49500	3.86e-12	69.7	666	0.101	0.053	MBR2_ARATH E3 ubiquitin-protein ligase MBR2 OS=Arabidopsis thaliana OX=3702 GN=MBR2 PE=1 SV=1
15	Q9ZQF9	6.46e-12	68.9	704	0.095	0.047	MBR1_ARATH E3 ubiquitin-protein ligase MBR1 OS=Arabidopsis thaliana OX=3702 GN=MBR1 PE=1 SV=1
16	Q8L649	8.47e-12	66.6	248	0.090	0.125	BB_ARATH E3 ubiquitin-protein ligase BIG BROTHER OS=Arabidopsis thaliana OX=3702 GN=BB PE=1 SV=1
17	Q7L0R7	9.61e-12	67.8	432	0.107	0.086	RNF44_HUMAN RING finger protein 44 OS=Homo sapiens OX=9606 GN=RNF44 PE=1 SV=1
18	Q94F54	1.12e-11	67.8	486	0.095	0.068	Q94F54_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=TEAR2 PE=2 SV=1
19	Q9H0F5	1.38e-11	67.8	515	0.098	0.066	RNF38_HUMAN E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens OX=9606 GN=RNF38 PE=1 SV=4
20	A0A8I5XVZ9	1.71e-11	67.4	526	0.098	0.065	A0A8I5XVZ9_RAT Ring finger protein 38 OS=Rattus norvegicus OX=10116 GN=Rnf38 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14446 Prok-RING_1	5.5e+02	11.9	Prokaryotic RING finger family 1
2	PF14447 Prok-RING_4	2.2	19.5	Prokaryotic RING finger family 4
3	PF12906 RINGv	8.8e+02	11.5	RING-variant domain
4	PF12861 zf-ANAPC11	42	15.6	Anaphase-promoting complex subunit 11 RING-H2 finger
5	PF00097 zf-C3HC4	0.00097	30.3	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	1.1e-06	39.7	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	0.00042	31.4	Zinc finger, C3HC4 type (RING finger)
8	PF11789 zf-Nse	5.4e+02	11.9	Zinc-finger of the MIZ type in Nse subunit
9	PF12678 zf-rbx1	0.005	28.4	RING-H2 zinc finger domain
10	PF17123 zf-RING_11	9.7e-06	36.5	RING-like zinc finger
11	PF17120 zf-RING_16	96	14.0	RING/Ubox like zinc-binding domain
12	PF13639 zf-RING_2	2.8e-10	51.7	Ring finger domain
13	PF14570 zf-RING_4	1.2e+02	13.8	RING/Ubox like zinc-binding domain
14	PF14634 zf-RING_5	0.0009	30.5	zinc-RING finger domain
15	PF13445 zf-RING_UBOX	0.05	25.0	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010385123.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010358500.1	0.810	SMAD family member 7
2	61622.XP_010361974.1	0.810	SMAD family member 6
3	61622.XP_010385198.1	0.676	Small ubiquitin-related modifier 1
4	61622.XP_010379494.1	0.643	UBX domain-containing protein 7
5	61622.XP_010370914.1	0.638	Ski-like protein isoform X1
6	61622.XP_010369398.1	0.615	Damage specific DNA binding protein 2
7	61622.XP_010359921.1	0.605	UV excision repair protein RAD23 homolog A isoform X1
8	61622.XP_010387756.1	0.605	UV excision repair protein RAD23 homolog B
9	61622.XP_010358460.1	0.598	Small ubiquitin-related modifier 3
10	61622.XP_010379329.1	0.598	Small ubiquitin-related modifier 4
11	61622.XP_010385925.1	0.598	Small ubiquitin-like modifier 2
12	61622.XP_010366723.1	0.597	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 mRNAs, 18137 ESTs, 162 Proteins, and 92% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
13	61622.XP_010386044.1	0.597	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 2292 ESTs, 288 Proteins, and 87% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
14	61622.XP_010381393.1	0.595	SMAD family member 9
15	61622.XP_010351026.1	0.583	Nucleoporin 153
16	61622.XP_010353041.1	0.578	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
17	61622.XP_010358365.1	0.578	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
18	61622.XP_010351398.1	0.571	Centrin 2
19	61622.XP_010353198.1	0.571	Centrin-1
20	61622.XP_010378294.1	0.570	Axin 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	0.995	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0071704	0.965	organic substance metabolic process
GO:0044238	0.957	primary metabolic process
GO:0006807	0.949	nitrogen compound metabolic process
GO:0043170	0.934	macromolecule metabolic process
GO:1901564	0.926	organonitrogen compound metabolic process
GO:0032446	0.918	protein modification by small protein conjugation
GO:0016567	0.865	protein ubiquitination
GO:0032502	0.858	developmental process
GO:0048856	0.854	anatomical structure development
GO:0050896	0.818	response to stimulus
GO:0048518	0.817	positive regulation of biological process
GO:0032501	0.806	multicellular organismal process
GO:0009966	0.718	regulation of signal transduction
GO:0090092	0.675	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048522	0.667	positive regulation of cellular process
GO:0007275	0.622	multicellular organism development
GO:0090287	0.357	regulation of cellular response to growth factor stimulus
GO:0019222	0.351	regulation of metabolic process
GO:0042221	0.315	response to chemical
GO:0000209	0.301	protein polyubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.997	protein-containing complex
GO:0005737	0.547	cytoplasm
GO:0031981	0.478	nuclear lumen
GO:0005654	0.463	nucleoplasm
GO:0005829	0.426	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]