StarFunc result for job id Q6ZSS7

User Input

>input (791 residues)
MADDKVAILTDDEEEQKRKYVLADPFNGISREPEPPSNETPSSTETSAIPEEEIDWIEKH
CVKINNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPF
WGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILP
TNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDL
TLNSSTATPVSPGSVTKETTTVIVTTTKSLPSDQVMLVYDQQEVEAIFLVILVVVIIGEF
FSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGC
KPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNHFKNDDSKGKEVEIPQVERNNSTESS
EETPTTTSHSQAFNFWDLIKLLCSVQYGSVLFVAWFMGFGYGFVFTFLYWHLEDLNGTTT
LFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPME
VLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYFGAA
ATFRGIGMACLVILLLFALIQWLAVPDEEEDKTMLAERIPVPSSPVPIATIDLVQQQTED
VMPRIEPRLPPKKTKHQEEQEDVNKPAWGVSSSPWVTFVYALYQIKEMMQLTRDNRASEI
QPLQGTNENRENSPAGRAQPVPCETHSDPSRNQPSPDAAASQTQTSPAHPSVDPCTEESE
EQQAQLAAGGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZSS7	1.000	1.000	2.146E-92	791	1.000	1.000	Q6ZSS7.pdb.gz	MFSD6_HUMAN Major facilitator superfamily domain-containing protein 6 OS=Homo sapiens OX=9606 GN=MFSD6 PE=1 SV=2
2	AFDB:Q8CBH5	0.837	0.854	3.922E-76	775	0.827	0.844	Q8CBH5.pdb.gz	MFSD6_MOUSE Major facilitator superfamily domain-containing protein 6 OS=Mus musculus OX=10090 GN=Mfsd6 PE=1 SV=1
3	AFDB:Q95Y88	0.496	0.617	4.847E-23	630	0.231	0.290	Q95Y88.pdb.gz	Q95Y88_CAEEL Major facilitator superfamily associated domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mfsd-6 PE=1 SV=1
4	AFDB:Q47142	0.415	0.836	2.565E-9	379	0.088	0.185	Q47142.pdb.gz	HCAT_ECOLI Probable 3-phenylpropionic acid transporter OS=Escherichia coli (strain K12) OX=83333 GN=hcaT PE=1 SV=2
5	AFDB:P47159	0.431	0.733	9.318E-9	448	0.085	0.150	P47159.pdb.gz	YJ94_YEAST Uncharacterized membrane protein YJR124C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YJR124C PE=1 SV=1
6	AFDB:A0A0R4IHG0	0.409	0.620	2.004E-8	495	0.096	0.154	A0A0R4IHG0.pdb.gz
7	AFDB:O15403	0.391	0.561	8.552E-8	523	0.106	0.161	O15403.pdb.gz	MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens OX=9606 GN=SLC16A6 PE=1 SV=2
8	AFDB:P31675	0.417	0.801	8.552E-8	392	0.068	0.138	P31675.pdb.gz	SETA_ECOLI Sugar efflux transporter A OS=Escherichia coli (strain K12) OX=83333 GN=setA PE=1 SV=3
9	AFDB:P53988	0.409	0.637	1.697E-7	484	0.082	0.134	P53988.pdb.gz	MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus OX=10036 GN=SLC16A7 PE=1 SV=1
10	AFDB:O15375	0.396	0.594	2.343E-7	505	0.104	0.162	O15375.pdb.gz	MOT6_HUMAN Monocarboxylate transporter 6 OS=Homo sapiens OX=9606 GN=SLC16A5 PE=1 SV=1
11	PDB:1pv7A	0.421	0.764	3.376E-7	417	0.095	0.180	1pv7A.pdb.gz
12	PDB:7dl9A	0.412	0.773	4.852E-7	405	0.090	0.175	7dl9A.pdb.gz
13	PDB:6fmrA	0.392	0.624	1.214E-4	475	0.081	0.135	6fmrA.pdb.gz	In situ serial crystallography for rapid de novo membrane protein structure determination.
14	PDB:4q65A	0.376	0.637	1.968E-4	437	0.061	0.110	4q65A.pdb.gz
15	PDB:7yr5A	0.392	0.747	2.610E-4	385	0.063	0.130	7yr5A.pdb.gz
16	PDB:4oh3A	0.378	0.551	3.461E-4	512	0.083	0.129	4oh3A.pdb.gz
17	PDB:6kkkA	0.390	0.760	3.906E-4	381	0.068	0.142	6kkkA.pdb.gz
18	PDB:4oh3B	0.376	0.527	4.589E-4	537	0.077	0.114	4oh3B.pdb.gz
19	PDB:1pw4A	0.418	0.724	5.844E-4	434	0.080	0.145	1pw4A.pdb.gz
20	PDB:5oxpA	0.359	0.578	5.844E-4	462	0.091	0.156	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZSS7	0.0	1642	791	1.000	1.000	MFSD6_HUMAN Major facilitator superfamily domain-containing protein 6 OS=Homo sapiens OX=9606 GN=MFSD6 PE=1 SV=2
2	Q8CBH5	0.0	1350	775	0.823	0.840	MFSD6_MOUSE Major facilitator superfamily domain-containing protein 6 OS=Mus musculus OX=10090 GN=Mfsd6 PE=1 SV=1
3	Q95Y88	2.67e-72	250	630	0.245	0.308	Q95Y88_CAEEL Major facilitator superfamily associated domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mfsd-6 PE=1 SV=1
4	B7Z0G4	4.76e-22	103	588	0.113	0.151	B7Z0G4_DROME FI11563p OS=Drosophila melanogaster OX=7227 GN=Sugb PE=1 SV=1
5	Q9VTL9	4.91e-22	103	604	0.113	0.147	Q9VTL9_DROME Sugar baby, isoform C OS=Drosophila melanogaster OX=7227 GN=Sugb PE=1 SV=2
6	Q7KUF9	5.73e-22	103	590	0.113	0.151	Q7KUF9_DROME Sugar baby, isoform F OS=Drosophila melanogaster OX=7227 GN=Sugb PE=1 SV=3
7	Q86PB0	1.20e-21	102	588	0.113	0.151	Q86PB0_DROME LD37218p OS=Drosophila melanogaster OX=7227 GN=Sugb PE=2 SV=1
8	Q95S75	7.82e-14	72.8	189	0.049	0.206	Q95S75_DROME GM06782p OS=Drosophila melanogaster OX=7227 GN=Sugb PE=2 SV=1
9	P25744	0.003	43.1	408	0.040	0.078	MDTG_ECOLI Multidrug resistance protein MdtG OS=Escherichia coli (strain K12) OX=83333 GN=mdtG PE=3 SV=1
10	O74852	0.28	37.0	448	0.039	0.069	YQ92_SCHPO Uncharacterized MFS-type transporter C18.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC18.02 PE=3 SV=1
11	P76417	0.42	36.2	425	0.039	0.073	YEGT_ECOLI Putative nucleoside transporter YegT OS=Escherichia coli (strain K12) OX=83333 GN=yegT PE=1 SV=1
12	O23203	1.1	35.0	489	0.032	0.051	O23203_ARATH Major facilitator superfamily protein OS=Arabidopsis thaliana OX=3702 GN=C7A10.570 PE=1 SV=1
13	Q9VCJ5	1.4	34.7	602	0.032	0.042	Q9VCJ5_DROME Portabella OS=Drosophila melanogaster OX=7227 GN=prt PE=4 SV=2
14	P69367	2.1	33.9	402	0.027	0.052	MDTH_ECOLI Multidrug resistance protein MdtH OS=Escherichia coli (strain K12) OX=83333 GN=mdtH PE=1 SV=1
15	Q9GNP0	2.1	34.3	553	0.038	0.054	Q9GNP0_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cat-1 PE=1 SV=4
16	Q1RLY4	3.5	33.5	547	0.029	0.042	Q1RLY4_DANRE Natural resistance-associated macrophage protein 2 OS=Danio rerio OX=7955 GN=fa07b10 PE=2 SV=1
17	Q9Z1G4	3.5	33.5	839	0.038	0.036	VPP1_MOUSE V-type proton ATPase 116 kDa subunit a 1 OS=Mus musculus OX=10090 GN=Atp6v0a1 PE=1 SV=3
18	O70451	4.0	33.1	484	0.033	0.054	MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus OX=10090 GN=Slc16a7 PE=1 SV=1
19	Q8RWN2	4.5	33.1	486	0.023	0.037	ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana OX=3702 GN=ZIF1 PE=1 SV=2
20	Q9FLC6	4.5	32.3	176	0.028	0.125	ATL73_ARATH RING-H2 finger protein ATL73 OS=Arabidopsis thaliana OX=3702 GN=ATL73 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12420 DUF3671	2e+02	13.4	Protein of unknown function
2	PF17231 DUF5305	1.6e+02	13.3	Family of unknown function (DUF5305)
3	PF01306 LacY_symp	0.0015	29.0	LacY proton/sugar symporter
4	PF07690 MFS_1	2.1e-27	107.6	Major Facilitator Superfamily
5	PF12832 MFS_1_like	1.7e-89	312.0	MFS_1 like family
6	PF05977 MFS_3	1.3	19.0	Transmembrane secretion effector
7	PF03825 Nuc_H_symport	0.00018	32.3	Nucleoside H+ symporter
8	PF03137 OATP	6.2	16.6	Organic Anion Transporter Polypeptide (OATP) family
9	PF16038 TMIE	3.8e+02	12.3	TMIE protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376141

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380019	0.816	Zinc finger protein 384
2	9606.ENSP00000393675	0.727	Mitoguardin 1
3	9606.ENSP00000336894	0.721	NGFI-A-binding protein 1
4	9606.ENSP00000363590	0.714	Chondroitin sulfate N-acetylgalactosaminyltransferase 2
5	9606.ENSP00000376103	0.699	Protein C19orf12
6	9606.ENSP00000386292	0.663	Nuclear envelope integral membrane protein 2
7	9606.ENSP00000238936	0.659	Transmembrane protein 180
8	9606.ENSP00000347583	0.649	Major facilitator superfamily domain containing 12
9	9606.ENSP00000332646	0.644	Major facilitator superfamily domain-containing protein 10
10	9606.ENSP00000258436	0.643	Major facilitator superfamily domain containing 9
11	9606.ENSP00000380659	0.634	Eukaryotic translation initiation factor 4E transporter
12	9606.ENSP00000322300	0.630	Transmembrane and tetratricopeptide repeat containing 2
13	9606.ENSP00000347839	0.627	Rab11 family-interacting protein 2
14	9606.ENSP00000371661	0.620	Ligand-dependent nuclear receptor corepressor-like protein
15	9606.ENSP00000362094	0.613	Gametocyte-specific factor 1-like
16	9606.ENSP00000351157	0.611	Acts as a positive regulator of ciliary hedgehog signaling (By similarity). Involved in ciliogenesis .
17	9606.ENSP00000442688	0.604	Molybdate-anion transporter
18	9606.ENSP00000342313	0.593	Sterile alpha motif domain-containing protein 11
19	9606.ENSP00000357840	0.593	Sodium-dependent glucose transporter 1
20	9606.ENSP00000438040	0.590	Coiled-coil domain-containing protein 91

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042288	0.838	MHC class I protein binding
GO:0140375	0.829	immune receptor activity
GO:0004888	0.801	transmembrane signaling receptor activity
GO:0032393	0.584	MHC class I receptor activity
GO:0005215	0.437	transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.800	cellular process
GO:0019882	0.465	antigen processing and presentation
GO:0048002	0.461	antigen processing and presentation of peptide antigen
GO:0019884	0.460	antigen processing and presentation of exogenous antigen
GO:0006810	0.433	transport
GO:0002478	0.322	antigen processing and presentation of exogenous peptide antigen
GO:0065007	0.307	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005886	0.925	plasma membrane
GO:0005622	0.445	intracellular anatomical structure
GO:0043229	0.435	intracellular organelle
GO:0043227	0.427	membrane-bounded organelle
GO:0043231	0.408	intracellular membrane-bounded organelle
GO:0005737	0.399	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]