StarFunc result for job id Q6ZSZ5

User Input

>input (1361 residues)
MGDDQEDDFPRRLSESMEDLSLDLGALQGSEYLQDLGLGAPSHSQPGETPDSRPTGEEPG
RDSLFSSLAGSQDLSRRRSWERSRSCSESWRRLSLDASAVDEEPCLPRTLASLALNLPGG
GLKTWTQGCLSGGGTPAESPGKECDSPKKRGRSRSVPVSFYEIRSPEISPGLEVPTPPVQ
GLEPPVLECMEKDHVEPDHVLIVQQVLQELRQYHGARQRACMSASPGGAHSNLTWFEFLS
ESEDGAGKNEKSDKSTSVKRRLSCLRSRVTRQKEKGKSPAHLKDKGQDARERRECVNGHQ
LLQGTFSGPSSCPLCGKPFLSSASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPS
PAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESIFVEDPYTASLRSEIESD
GHEFEAESWSLAVDAAYAKKQKREVVKRQDVLYELMQTEVHHVRTLKIMLKVYSRALQEE
LQFSSKAIGRLFPCADDLLETHSHFLARLKERRQESLEEGSDRNYVIQKIGDLLVQQFSG
ENGERMKEKYGVFCSGHNEAVSHYKLLLQQNKKFQNLIKKIGNFSIVRRLGVQECILLVT
QRITKYPVLVERIIQNTEAGTEDYEDLTQALNLIKDIISQVDAKVSECEKGQRLREIAGK
MDLKSSSKLKNGLTFRKEDMLQRQLHLEGMLCWKTTSGRLKDILAILLTDVLLLLQEKDQ
KYVFASVDSKPPVISLQKLIVREVANEEKAMFLISASLQGPEMYEIYTSSKEDRNAWMAH
IQRAVESCPDEEEGPFSLPEEERKVVEARATRLRDFQERLSMKDQLIAQSLLEKQQIYLE
MAEMGGLEDLPQPRGLFRGGDPSETLQGELILKSAMSEIEGIQSLICRQLGSANGQAEDG
GSSTGPPRRAETFAGYDCTNSPTKNGSFKKKVSSTDPRPRDWRGPPNSPDLKLSDSDIPG
SSEESPQVVEAPGTESDPRLPTVLESELVQRIQTLSQLLLNLQAVIAHQDSYVETQRAAI
QEREKQFRLQSTRGNLLLEQERQRNFEKQREERAALEKLQSQLRHEQQRWERERQWQHQE
LERAGARLQEREGEARQLRERLEQERAELERQRQAYQHDLERLREAQRAVERERERLELL
RRLKKQNTAPGALPPDTLAEAQPPSHPPSFNGEGLEGPRVSMLPSGVGPEYAERPEVARR
DSAPTENRLAKSDVPIQLLSATNQFQRQAAVQQQIPTKLAASTKGGKDKGGKSRGSQRWE
SSASFDLKQQLLLNKLMGKDESTSRNRRSLSPILPGRHSPAPPPDPGFPAPSPPPADSPS
EGFSLKAGGTALLPGPPAPSPLPATPLSAKEDASKEDVIFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZSZ5	0.999	0.999	0.000	1361	1.000	1.000	Q6ZSZ5.pdb.gz	ARHGI_HUMAN Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=4
2	AFDB:F6P6M2	0.310	0.244	8.301E-63	1753	0.334	0.259	F6P6M2.pdb.gz	F6P6M2_DANRE Rho guanine nucleotide exchange factor (GEF) 28a OS=Danio rerio OX=7955 GN=arhgef28 PE=4 SV=1
3	AFDB:P98174	0.141	0.183	7.532E-19	961	0.108	0.153	P98174.pdb.gz	FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2
4	AFDB:Q54DW4	0.207	0.209	6.180E-18	1350	0.104	0.105	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
5	AFDB:Q54YZ6	0.205	0.227	1.228E-17	1218	0.095	0.106	Q54YZ6.pdb.gz	Q54YZ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=gxcA PE=4 SV=1
6	AFDB:Q9VW85	0.222	0.185	1.543E-17	1661	0.140	0.114	Q9VW85.pdb.gz	Q9VW85_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG13812 PE=1 SV=4
7	AFDB:Q8IQ97	0.210	0.218	1.745E-16	1311	0.104	0.108	Q8IQ97.pdb.gz	Q8IQ97_DROME Pebble, isoform B OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
8	AFDB:Q9Y7U6	0.219	0.223	1.912E-16	1334	0.104	0.106	Q9Y7U6.pdb.gz	RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rgf1 PE=1 SV=1
9	AFDB:Q12774	0.219	0.189	2.296E-16	1597	0.097	0.083	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
10	AFDB:Q54DW7	0.209	0.282	3.861E-14	986	0.104	0.143	Q54DW7.pdb.gz	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
11	PDB:7rx9A	0.131	0.393	1.685E-13	432	0.048	0.153	7rx9A.pdb.gz
12	PDB:4mt6A	0.185	0.532	2.321E-13	389	0.042	0.147	4mt6A.pdb.gz
13	PDB:4gouA	0.128	0.323	3.408E-8	507	0.035	0.093	4gouA.pdb.gz
14	PDB:6u3eA	0.066	0.188	1.174E-4	397	0.034	0.116	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	PDB:6bbpA	0.063	0.150	1.943E-4	520	0.048	0.127	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
16	PDB:6hhgA	0.065	0.215	6.995E-4	386	0.010	0.034	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
17	PDB:3ljuX	0.070	0.231	7.666E-4	373	0.013	0.048	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
18	PDB:5yqrA	0.073	0.325	1.390E-3	268	0.021	0.104	5yqrA.pdb.gz
19	PDB:6s9wA	0.069	0.214	2.299E-3	411	0.010	0.032	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
20	PDB:4mk0A	0.066	0.134	2.637E-3	631	0.018	0.040	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WZG4	0.0	2103	1173	0.763	0.886	A0A087WZG4_HUMAN Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=3
2	A0A3B3IPE9	0.0	2101	1119	0.763	0.929	A0A3B3IPE9_HUMAN Rho/Rac guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=2
3	A0A590UK10	0.0	2205	1089	0.799	0.999	A0A590UK10_HUMAN Rho guanine nucleotide exchange factor 18 (Fragment) OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=4 SV=1
4	F1QCK8	0.0	843	1012	0.385	0.518	F1QCK8_DANRE Rho guanine nucleotide exchange factor 18 isoform X2 OS=Danio rerio OX=7955 GN=arhgef18b PE=1 SV=2
5	M0QZS0	0.0	1630	812	0.596	0.999	M0QZS0_HUMAN Rho guanine nucleotide exchange factor 18 (Fragment) OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=1
6	P97433	0.0	636	1700	0.322	0.258	ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus OX=10090 GN=Arhgef28 PE=1 SV=2
7	Q6ZSZ5	0.0	2763	1361	1.000	1.000	ARHGI_HUMAN Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=4
8	Q8N1W1	0.0	605	1705	0.303	0.242	ARG28_HUMAN Rho guanine nucleotide exchange factor 28 OS=Homo sapiens OX=9606 GN=ARHGEF28 PE=1 SV=3
9	A8MYJ1	2.39e-178	570	1434	0.274	0.260	A8MYJ1_HUMAN A-kinase anchoring protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=3
10	A0A087WTD7	2.48e-177	567	1429	0.274	0.261	A0A087WTD7_HUMAN A-kinase anchoring protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=1
11	E9Q394	2.65e-175	581	2776	0.273	0.134	AKP13_MOUSE A-kinase anchor protein 13 OS=Mus musculus OX=10090 GN=Akap13 PE=1 SV=1
12	Q12802	9.33e-171	568	2813	0.274	0.133	AKP13_HUMAN A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=2
13	F1M3G7	4.68e-164	548	2760	0.250	0.123	AKP13_RAT A-kinase anchor protein 13 OS=Rattus norvegicus OX=10116 GN=Akap13 PE=1 SV=2
14	F6P6M2	4.07e-150	499	1753	0.186	0.144	F6P6M2_DANRE Rho guanine nucleotide exchange factor (GEF) 28a OS=Danio rerio OX=7955 GN=arhgef28 PE=4 SV=1
15	F1RLP5	1.39e-144	468	987	0.240	0.331	F1RLP5_PIG Rho guanine nucleotide exchange factor 2 OS=Sus scrofa OX=9823 GN=ARHGEF2 PE=4 SV=4
16	Q60875	2.17e-144	467	985	0.238	0.329	ARHG2_MOUSE Rho guanine nucleotide exchange factor 2 OS=Mus musculus OX=10090 GN=Arhgef2 PE=1 SV=4
17	B2DCZ9	1.97e-143	464	961	0.216	0.306	ARHG2_PIG Rho guanine nucleotide exchange factor 2 OS=Sus scrofa OX=9823 GN=ARHGEF2 PE=2 SV=1
18	Q865S3	4.67e-143	463	986	0.239	0.330	ARHG2_CANLF Rho guanine nucleotide exchange factor 2 OS=Canis lupus familiaris OX=9615 GN=ARHGEF2 PE=1 SV=1
19	Q5FVC2	6.67e-143	463	985	0.238	0.329	ARHG2_RAT Rho guanine nucleotide exchange factor 2 OS=Rattus norvegicus OX=10116 GN=Arhgef2 PE=1 SV=1
20	Q92974	1.19e-141	459	986	0.237	0.328	ARHG2_HUMAN Rho guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=ARHGEF2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	0.0043	28.9	PH domain
2	PF17838 PH_16	6.4e-36	134.4	PH domain
3	PF00621 RhoGEF	1.5e-28	111.8	RhoGEF domain
4	PF13894 zf-C2H2_4	6e+02	12.8	C2H2-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005587801.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005547162.1	0.978	Transforming protein RhoA
2	9541.XP_005541935.1	0.971	Uncharacterized protein
3	9541.XP_005595823.1	0.914	Active breakpoint cluster region-related protein-like
4	9541.XP_005596100.1	0.901	Protein EHM2
5	9541.XP_005581186.1	0.889	Trimeric intracellular cation channel type B
6	9541.XP_005543269.1	0.871	inaD-like protein-like isoform X1
7	9541.XP_005542360.1	0.858	Ras homolog family member C
8	9541.XP_005583215.1	0.849	Active breakpoint cluster region-related protein
9	9541.XP_005576528.1	0.813	Rho-related GTP-binding protein RhoB
10	9541.XP_005576604.1	0.796	Protein kinase which is a key regulator of actin cytoskeleton and cell polarity
11	9541.XP_005572293.1	0.784	Uncharacterized protein
12	9541.XP_005567434.1	0.761	Uncharacterized protein
13	9541.XP_005563304.1	0.757	Rho guanine nucleotide exchange factor 10
14	9541.XP_005585469.1	0.757	Uncharacterized protein
15	9541.XP_005564998.1	0.747	Partitioning defective 3 homolog isoform X1
16	9541.XP_005544679.1	0.727	Uncharacterized protein
17	9541.XP_005569947.1	0.696	Pleckstrin homology domain-containing family G member 6 isoform X1
18	9541.XP_005559280.1	0.689	Rho-related GTP-binding protein RhoV
19	9541.XP_005540231.1	0.686	Regulator of G-protein signaling 16
20	9541.XP_005551106.1	0.682	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0019899	0.358	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0016043	0.960	cellular component organization
GO:0051716	0.959	cellular response to stimulus
GO:0006996	0.949	organelle organization
GO:0007154	0.937	cell communication
GO:0051128	0.912	regulation of cellular component organization
GO:0032956	0.885	regulation of actin cytoskeleton organization
GO:1902903	0.881	regulation of supramolecular fiber organization
GO:0023052	0.877	signaling
GO:0030029	0.846	actin filament-based process
GO:0007010	0.837	cytoskeleton organization
GO:0007165	0.835	signal transduction
GO:0044087	0.813	regulation of cellular component biogenesis
GO:0048519	0.802	negative regulation of biological process
GO:0051179	0.778	localization
GO:0048523	0.757	negative regulation of cellular process
GO:0110020	0.719	regulation of actomyosin structure organization
GO:0010639	0.680	negative regulation of organelle organization
GO:0022603	0.660	regulation of anatomical structure morphogenesis
GO:0022604	0.574	regulation of cell morphogenesis
GO:0032231	0.574	regulation of actin filament bundle assembly
GO:0051641	0.552	cellular localization
GO:0008360	0.525	regulation of cell shape
GO:1902414	0.503	protein localization to cell junction
GO:1902904	0.499	negative regulation of supramolecular fiber organization
GO:0030036	0.475	actin cytoskeleton organization
GO:0023051	0.417	regulation of signaling
GO:0010646	0.417	regulation of cell communication
GO:0051492	0.413	regulation of stress fiber assembly
GO:0048583	0.407	regulation of response to stimulus
GO:0009966	0.402	regulation of signal transduction
GO:0051056	0.381	regulation of small GTPase mediated signal transduction
GO:0007264	0.310	small GTPase mediated signal transduction
GO:0051494	0.309	negative regulation of cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0016020	0.928	membrane
GO:0043226	0.899	organelle
GO:0030054	0.863	cell junction
GO:0071944	0.843	cell periphery
GO:0005886	0.822	plasma membrane
GO:0043227	0.573	membrane-bounded organelle
GO:0031982	0.459	vesicle
GO:0043229	0.400	intracellular organelle
GO:0070062	0.311	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]