StarFunc result for job id Q6ZSZ6

User Input

>input (1077 residues)
MPRRKQQAPRRSAAYVPEEELKAAEIDEEHVEDDGLSLDIQESEYMCNEETEIKEAQSYQ
NSPVSSATNQDAGYGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSYPQDSLAQIKAVY
ANLFSESCWSSLALDLKKSGSTTSTNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTSCS
SSTSHSSTTSTSSSSGYDWHQAALAKTLQQTSSYGLLPEPSLFSTVQLYRQNNKLYGSVF
TGASKFRCKDCSAAYDTLVELTVHMNETGHYRDDNRDKDSEKTKRWSKPRKRSLMEMEGK
EDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKVPLKEPVPAITKLVPSTKKRALQDLA
PPCSPEPAGMAAEVALSESAKDQKAANPYVTPNNRYGYQNGASYTWQFEARKAQILKCME
CGSSHDTLQQLTAHMMVTGHFLKVTTSASKKGKQLVLDPVVEEKIQSIPLPPTTHTRLPA
SSIKKQPDSPAGSTTSEEKKEPEKEKPPVAGDAEKIKEESEDSLEKFEPSTLYPYLREED
LDDSPKGGLDILKSLENTVSTAISKAQNGAPSWGGYPSIHAAYQLPGTVKPLPAAVQSVQ
VQPSYAGGVKSLSSAEHNALLHSPGSLTPPPHKSNVSAMEELVEKVTGKVNIKKEERPPE
KEKSSLAKAASPIAKENKDFPKTEEVSGKPQKKGPEAETGKAKKEGPLDVHTPNGTEPLK
AKVTNGCNNLGIIMDHSPEPSFINPLSALQSIMNTHLGKVSKPVSPSLDPLAMLYKISNS
MLDKPVYPATPVKQADAIDRYYYENSDQPIDLTKSKNKPLVSSVADSVASPLRESALMDI
SDMVKNLTGRLTPKSSTPSTVSEKSDADGSSFEEALDELSPVHKRKGRQSNWNPQHLLIL
QAQFASSLRETTEGKYIMSDLGPQERVHISKFTGLSMTTISHWLANVKYQLRRTGGTKFL
KNLDTGHPVFFCNDCASQFRTASTYISHLETHLGFSLKDLSKLPLNQIQEQQNVSKVLTN
KTLGPLGATEEDLGSTFQCKLCNRTFASKHAVKLHLSKTHGKSPEDHLIYVTELEKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NAP3	0.057	0.051	5.371E-7	1195	0.159	0.143	Q8NAP3.pdb.gz	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
2	AFDB:Q5EXX3	0.053	0.050	3.227E-6	1203	0.143	0.128	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
3	AFDB:Q13029	0.060	0.043	3.973E-5	1718	0.162	0.102	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
4	AFDB:Q9H582	0.065	0.055	3.628E-4	1327	0.127	0.103	Q9H582.pdb.gz	ZN644_HUMAN Zinc finger protein 644 OS=Homo sapiens OX=9606 GN=ZNF644 PE=1 SV=2
5	AFDB:Q9VWC6	0.043	0.035	5.852E-4	1596	0.133	0.090	Q9VWC6.pdb.gz	Q9VWC6_DROME FI17950p1 OS=Drosophila melanogaster OX=7227 GN=zld PE=2 SV=1
6	AFDB:A0A0K3AUE4	0.038	0.030	3.516E-3	1968	0.149	0.081	A0A0K3AUE4.pdb.gz	SEA2_CAEEL Signal element on autosome protein 2 OS=Caenorhabditis elegans OX=6239 GN=sea-2 PE=1 SV=1
7	AFDB:Q8BG87	0.042	0.031	5.672E-3	1803	0.131	0.078	Q8BG87.pdb.gz	TET3_MOUSE Methylcytosine dioxygenase TET3 OS=Mus musculus OX=10090 GN=Tet3 PE=1 SV=4
8	AFDB:A2A7B5	0.072	0.056	6.021E-3	1709	0.155	0.098	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
9	AFDB:A2BIH4	0.055	0.052	1.310E-2	1169	0.156	0.144	A2BIH4.pdb.gz	A2BIH4_DANRE Zinc finger protein 644a OS=Danio rerio OX=7955 GN=fi40c02 PE=4 SV=1
10	AFDB:Q05GC8	0.055	0.050	1.766E-2	1220	0.142	0.125	Q05GC8.pdb.gz	Q05GC8_HUMAN Breast cancer anti-estrogen resistance 2 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
11	PDB:4zzlA	0.045	0.147	4.991E-1	146	0.020	0.151	4zzlA.pdb.gz
12	PDB:6gejS	0.048	0.158	6.339E-1	208	0.031	0.159	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
13	PDB:7tnxA	0.027	0.041	1.554	647	0.006	0.011	7tnxA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
14	PDB:2cyyA	0.048	0.246	1.751	151	0.011	0.079	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
15	PDB:5y6lB	0.042	0.186	1.859	173	0.013	0.081	5y6lB.pdb.gz
16	PDB:7a6hO	0.041	0.068	1.859	512	0.017	0.035	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
17	PDB:7fbyA	0.049	0.239	1.859	153	0.011	0.078	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
18	PDB:2hi3A	0.048	0.539	2.095	73	0.011	0.164	2hi3A.pdb.gz
19	PDB:1rquA	0.025	0.186	2.361	120	0.016	0.142	1rquA.pdb.gz
20	PDB:4btsA9	0.036	0.166	2.999	93	0.014	0.161	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0SNQ7	0.0	1050	1004	0.538	0.577	A0SNQ7_XENLA Teashirt zinc finger homeobox 3 L homeolog OS=Xenopus laevis OX=8355 GN=tshz3.L PE=1 SV=1
2	D3ZKB9	0.0	1078	1072	0.578	0.580	TSH3_RAT Teashirt homolog 3 OS=Rattus norvegicus OX=10116 GN=Tshz3 PE=1 SV=2
3	Q5DTH5	0.0	1936	1084	0.921	0.915	TSH1_MOUSE Teashirt homolog 1 OS=Mus musculus OX=10090 GN=Tshz1 PE=1 SV=2
4	Q63HK5	0.0	1113	1081	0.585	0.583	TSH3_HUMAN Teashirt homolog 3 OS=Homo sapiens OX=9606 GN=TSHZ3 PE=1 SV=2
5	Q68FE9	0.0	922	1030	0.508	0.531	TSH2_MOUSE Teashirt homolog 2 OS=Mus musculus OX=10090 GN=Tshz2 PE=1 SV=1
6	Q6ZSZ6	0.0	2218	1077	1.000	1.000	TSH1_HUMAN Teashirt homolog 1 OS=Homo sapiens OX=9606 GN=TSHZ1 PE=1 SV=2
7	Q8CGV9	0.0	1103	1081	0.585	0.583	TSH3_MOUSE Teashirt homolog 3 OS=Mus musculus OX=10090 GN=Tshz3 PE=1 SV=2
8	Q9NRE2	0.0	952	1034	0.525	0.546	TSH2_HUMAN Teashirt homolog 2 OS=Homo sapiens OX=9606 GN=TSHZ2 PE=1 SV=3
9	F1QV43	3.02e-171	531	1020	0.275	0.290	F1QV43_DANRE Teashirt homolog 2 isoform X2 OS=Danio rerio OX=7955 GN=tshz2 PE=3 SV=3
10	P22265	5.94e-07	56.2	954	0.039	0.044	TSH_DROME Protein teashirt OS=Drosophila melanogaster OX=7227 GN=tsh PE=1 SV=2
11	Q9U3V5	2.99e-06	53.9	1024	0.036	0.038	TIPT_DROME Protein tiptop OS=Drosophila melanogaster OX=7227 GN=tio PE=2 SV=2
12	B9A0M7	0.001	45.1	543	0.029	0.057	B9A0M7_DROME AT31036p OS=Drosophila melanogaster OX=7227 GN=BcDNA:LD21969 PE=1 SV=1
13	A3KMN0	0.005	43.1	651	0.030	0.049	A3KMN0_MOUSE Zbtb16 protein (Fragment) OS=Mus musculus OX=10090 GN=Zbtb16 PE=2 SV=1
14	Q05516	0.005	43.1	673	0.030	0.048	ZBT16_HUMAN Zinc finger and BTB domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZBTB16 PE=1 SV=2
15	Q3UQ17	0.006	43.1	673	0.030	0.048	Q3UQ17_MOUSE Zinc finger and BTB domain containing 16 OS=Mus musculus OX=10090 GN=Zbtb16 PE=1 SV=1
16	Q5S3S9	0.007	42.7	673	0.030	0.048	Q5S3S9_RAT Promyelocytic leukemia zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zbtb16 PE=1 SV=1
17	J3KTI4	0.020	41.6	1091	0.028	0.027	J3KTI4_HUMAN Zinc finger protein 521 OS=Homo sapiens OX=9606 GN=ZNF521 PE=1 SV=1
18	Q6P2D0	0.025	40.8	407	0.025	0.066	ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens OX=9606 GN=ZFP1 PE=1 SV=2
19	Q96K83	0.026	41.2	1311	0.028	0.023	ZN521_HUMAN Zinc finger protein 521 OS=Homo sapiens OX=9606 GN=ZNF521 PE=1 SV=1
20	Q9H9D4	0.034	40.8	720	0.022	0.033	ZN408_HUMAN Zinc finger protein 408 OS=Homo sapiens OX=9606 GN=ZNF408 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05542 DUF760	1.9e+02	13.9	Protein of unknown function (DUF760)
2	PF00096 zf-C2H2	4.2e-07	41.2	Zinc finger, C2H2 type
3	PF12756 zf-C2H2_2	1.2e-08	46.5	C2H2 type zinc-finger (2 copies)
4	PF18868 zf-C2H2_3rep	2.4	20.3	Zinc finger C2H2-type, 3 repeats
5	PF13894 zf-C2H2_4	2.2e-06	39.0	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	0.26	22.6	C2H2-type zinc finger
7	PF13913 zf-C2HC_2	2e+02	13.3	zinc-finger of a C2HC-type
8	PF16278 zf-C2HE	1.6	20.6	C2HE / C2H2 / C2HC zinc-binding finger
9	PF12874 zf-met	8.3	18.2	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003827351.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003829836.1	0.653	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family
2	9597.XP_003813062.1	0.620	Zinc finger protein 503
3	9597.XP_008962189.1	0.553	Iroquois homeobox 3
4	9597.XP_008958326.1	0.545	Iroquois homeobox 1
5	9597.XP_008959921.1	0.537	UBX domain-containing protein 11 isoform X1
6	9597.XP_008962778.1	0.537	Zinc finger protein 770 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.639	heterocyclic compound binding
GO:0003677	0.617	DNA binding
GO:0043565	0.565	sequence-specific DNA binding
GO:0003690	0.442	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.972	regulation of biological process
GO:0032502	0.888	developmental process
GO:0050794	0.880	regulation of cellular process
GO:0048856	0.871	anatomical structure development
GO:0019222	0.854	regulation of metabolic process
GO:0032501	0.808	multicellular organismal process
GO:0060255	0.791	regulation of macromolecule metabolic process
GO:0051171	0.702	regulation of nitrogen compound metabolic process
GO:0080090	0.695	regulation of primary metabolic process
GO:0031323	0.621	regulation of cellular metabolic process
GO:0010468	0.616	regulation of gene expression
GO:0007275	0.585	multicellular organism development
GO:0048519	0.580	negative regulation of biological process
GO:0019219	0.493	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.490	cellular process
GO:0031326	0.485	regulation of cellular biosynthetic process
GO:0006355	0.484	regulation of DNA-templated transcription
GO:0009892	0.469	negative regulation of metabolic process
GO:0048523	0.459	negative regulation of cellular process
GO:0010605	0.442	negative regulation of macromolecule metabolic process
GO:0048513	0.424	animal organ development
GO:0051172	0.414	negative regulation of nitrogen compound metabolic process
GO:0031324	0.405	negative regulation of cellular metabolic process
GO:0051253	0.362	negative regulation of RNA metabolic process
GO:0010558	0.356	negative regulation of macromolecule biosynthetic process
GO:0031327	0.356	negative regulation of cellular biosynthetic process
GO:1903507	0.353	negative regulation of nucleic acid-templated transcription
GO:0045892	0.329	negative regulation of DNA-templated transcription
GO:0048518	0.314	positive regulation of biological process
GO:0048522	0.304	positive regulation of cellular process
GO:0009790	0.300	embryo development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.997	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0005737	0.974	cytoplasm
GO:0016020	0.830	membrane
GO:0071944	0.798	cell periphery
GO:0005886	0.758	plasma membrane
GO:0043232	0.375	intracellular non-membrane-bounded organelle
GO:0005829	0.364	cytosol
GO:0005739	0.361	mitochondrion
GO:0120025	0.305	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]