StarFunc result for job id Q6ZT07

User Input

>input (1266 residues)
MWVNPEEVLLANALWITERANPYFILQRRKGHAGDGGGGGGLAGLLVGTLDVVLDSSARV
APYRILYQTPDSLVYWTIACGGSRKEITEHWEWLEQNLLQTLSIFENENDITTFVRGKIQ
GIIAEYNKINDVKEDDDTEKFKEAIVKFHRLFGMPEEEKLVNYYSCSYWKGKVPRQGWMY
LSINHLCFYSFLMGREAKLVIRWVDITQLEKNATLLLPDVIKVSTRSSEHFFSVFLNINE
TFKLMEQLANIAMRQLLDNEGFEQDRSLPKLKRKSPKKVSALKRDLDARAKSERYRALFR
LPKDEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKEENLCSLIIPLREVTIVEKA
DSSSVLPSPLSISTRNRMTFLFANLKDRDFLVQRISDFLQQTTSKIYSDKEFAGSYNSSD
DEVYSRPSSLVSSSPQRSTSSDADGERQFNLNGNSVPTATQTLMTMYRRRSPEEFNPKLA
KEFLKEQAWKIHFAEYGQGICMYRTEKTRELVLKGIPESMRGELWLLLSGAINEKATHPG
YYEDLVEKSMGKYNLATEEIERDLHRSLPEHPAFQNEMGIAALRRVLTAYAFRNPNIGYC
QAMNIVTSVLLLYAKEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELARDYVPQL
YDCMQDLGVISTISLSWFLTLFLSVMPFESAVVVVDCFFYEGIKVIFQLALAVLDANVDK
LLNCKDDGEAMTVLGRYLDSVTNKDSTLPPIPHLHSLLSDDVEPYPEVDIFRLIRTSYEK
FGTIRADLIEQMRFKQRLKVIQTLEDTTKRNVVRTIVTETSFTIDELEELYALFKAEHLT
SCYWGGSSNALDRHDPSLPYLEQYRIDFEQFKGMFALLFPWACGTHSDVLASRLFQLLDE
NGDSLINFREFVSGLSAACHGDLTEKLKLLYKMHVLPEPSSDQDEPDSAFEATQYFFEDI
TPECTHVVGLDSRSKQGADDGFVTVSLKPDKGKRANSQENRNYLRLWTPENKSKSKNAKD
LPKLNQGQFIELCKTMYNMFSEDPNEQELYHATAAVTSLLLEIGEVGKLFVAQPAKEGGS
GGSGPSCHQGIPGVLFPKKGPGQPYVVESVEPLPASLAPDSEEHSLGGQMEDIKLEDSSP
RDNGACSSMLISDDDTKDDSSMSSYSVLSAGSHEEDKLHCEDIGEDTVLVRSGQGTAALP
RSTSLDRDWAITFEQFLASLLTEPALVKYFDKPVCMMARITSAKNIRMMGKPLTSASDYE
ISAMSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q66K14	0.771	0.780	0.000	1250	0.626	0.634	Q66K14.pdb.gz	TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=3
2	AFDB:Q6ZT07	1.000	1.000	0.000	1266	1.000	1.000	Q6ZT07.pdb.gz	TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens OX=9606 GN=TBC1D9 PE=2 SV=2
3	AFDB:O95759	0.731	0.807	1.182E-100	1140	0.450	0.500	O95759.pdb.gz	TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens OX=9606 GN=TBC1D8 PE=1 SV=3
4	AFDB:B0R0W9	0.621	0.703	1.735E-94	1108	0.435	0.497	B0R0W9.pdb.gz	TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio OX=7955 GN=tbc1d8b PE=1 SV=1
5	AFDB:O43048	0.451	0.669	1.186E-32	834	0.155	0.235	O43048.pdb.gz	YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC215.01 PE=3 SV=4
6	AFDB:P53258	0.436	0.571	5.637E-32	950	0.173	0.231	P53258.pdb.gz	GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDR1 PE=1 SV=1
7	AFDB:O94711	0.409	0.694	2.032E-29	720	0.134	0.236	O94711.pdb.gz	GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp2 PE=3 SV=1
8	AFDB:Q9VGL8	0.216	0.690	1.316E-13	363	0.075	0.262	Q9VGL8.pdb.gz	TBWKD_DROME TBC1 domain family member whacked OS=Drosophila melanogaster OX=7227 GN=wkd PE=1 SV=1
9	AFDB:Q8C9V1	0.208	0.562	2.101E-12	444	0.077	0.221	Q8C9V1.pdb.gz	TB10C_MOUSE Carabin OS=Mus musculus OX=10090 GN=Tbc1d10c PE=1 SV=1
10	AFDB:Q9BXI6	0.212	0.508	2.291E-12	508	0.077	0.193	Q9BXI6.pdb.gz	TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens OX=9606 GN=TBC1D10A PE=1 SV=1
11	PDB:6xtbE	0.074	0.369	6.573E-7	235	0.024	0.128	6xtbE.pdb.gz
12	PDB:5yqrA	0.082	0.371	3.406E-6	268	0.027	0.127	5yqrA.pdb.gz
13	PDB:3ljuX	0.079	0.212	4.536E-4	373	0.020	0.067	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
14	PDB:7nkyQ	0.073	0.191	5.165E-4	404	0.037	0.116	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
15	PDB:7nkyO	0.067	0.171	5.881E-4	427	0.027	0.080	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
16	PDB:1lw3A	0.077	0.184	2.251E-3	513	0.044	0.109	1lw3A.pdb.gz
17	PDB:6upkH	0.069	0.181	3.047E-3	411	0.026	0.080	6upkH.pdb.gz	FACT caught in the act of manipulating the nucleosome.
18	PDB:7c3mA	0.064	0.123	3.783E-3	577	0.024	0.052	7c3mA.pdb.gz
19	PDB:7ukhI	0.073	0.463	4.906E-3	181	0.025	0.177	7ukhI.pdb.gz	Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.
20	PDB:4mk0A	0.077	0.144	5.123E-3	631	0.013	0.027	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L3A9	0.0	1484	1232	0.633	0.651	A1L3A9_HUMAN TBC1 domain family, member 9B (With GRAM domain) OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=1
2	B0R0W9	0.0	1009	1108	0.444	0.507	TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio OX=7955 GN=tbc1d8b PE=1 SV=1
3	O95759	0.0	1100	1140	0.443	0.492	TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens OX=9606 GN=TBC1D8 PE=1 SV=3
4	Q0IIM8	0.0	1077	1120	0.449	0.507	TBC8B_HUMAN TBC1 domain family member 8B OS=Homo sapiens OX=9606 GN=TBC1D8B PE=1 SV=2
5	Q66K14	0.0	1486	1250	0.635	0.643	TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=3
6	Q6ZT07	0.0	2632	1266	1.000	1.000	TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens OX=9606 GN=TBC1D9 PE=2 SV=2
7	P53258	1.19e-70	258	950	0.108	0.144	GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDR1 PE=1 SV=1
8	O43048	1.60e-67	247	834	0.146	0.222	YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC215.01 PE=3 SV=4
9	O94711	5.92e-54	204	720	0.118	0.207	GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp2 PE=3 SV=1
10	Q75JG4	1.16e-45	181	986	0.113	0.145	Q75JG4_DICDI RabGAP/TBC domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=cnrF PE=4 SV=1
11	Q96HU1	6.68e-45	177	749	0.073	0.123	SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens OX=9606 GN=SGSM3 PE=1 SV=1
12	Q8VCZ6	3.41e-44	175	750	0.072	0.121	SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus OX=10090 GN=Sgsm3 PE=1 SV=1
13	P87234	2.98e-39	158	635	0.071	0.142	GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp3 PE=1 SV=1
14	Q9VGL8	5.56e-37	145	363	0.062	0.215	TBWKD_DROME TBC1 domain family member whacked OS=Drosophila melanogaster OX=7227 GN=wkd PE=1 SV=1
15	Q23419	5.70e-37	153	908	0.068	0.095	Q23419_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tbc-2 PE=1 SV=2
16	Q8C9V1	2.16e-36	146	444	0.067	0.191	TB10C_MOUSE Carabin OS=Mus musculus OX=10090 GN=Tbc1d10c PE=1 SV=1
17	Q8IV04	4.42e-36	145	446	0.064	0.182	TB10C_HUMAN Carabin OS=Homo sapiens OX=9606 GN=TBC1D10C PE=1 SV=1
18	Q9UPU7	6.01e-36	150	963	0.082	0.108	TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens OX=9606 GN=TBC1D2B PE=1 SV=2
19	Q12317	4.51e-35	143	492	0.063	0.163	MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSB4 PE=1 SV=1
20	Q4KMP7	7.54e-33	140	808	0.067	0.105	TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens OX=9606 GN=TBC1D10B PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	1.3	19.8	EF hand
2	PF13405 EF-hand_6	2.5e+02	12.9	EF-hand domain
3	PF13499 EF-hand_7	76	15.2	EF-hand domain pair
4	PF02893 GRAM	8e-37	137.0	GRAM domain
5	PF00566 RabGAP-TBC	3.6e-44	162.5	Rab-GTPase-TBC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010354233.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010354235.1	0.729	ELMO domain-containing protein 2
2	61622.XP_010379265.1	0.715	TBC1 domain family member 9B isoform X1
3	61622.XP_010354654.1	0.710	Clathrin is the major protein of the polyhedral coat of coated pits and vesicles
4	61622.XP_010362354.1	0.710	Clathrin heavy chain 1 isoform X1
5	61622.XP_010371652.1	0.683	Type II inositol 3,4-bisphosphate 4-phosphatase
6	61622.XP_010373626.1	0.657	cyclin-G-associated kinase isoform X1
7	61622.XP_010385053.1	0.649	TBC1 domain family member 8
8	61622.XP_010365128.1	0.646	Demethylates proteins that have been reversibly carboxymethylated
9	61622.XP_010358668.1	0.642	Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3 isoform X1
10	61622.XP_010365134.1	0.624	Belongs to the mitochondrial carrier (TC 2.A.29) family.
11	61622.XP_010377207.1	0.619	Clathrin heavy chain linker domain containing 1
12	61622.XP_010377361.1	0.609	Matrix metalloproteinase-20
13	61622.XP_010386801.1	0.588	Small G protein signaling modulator 2 isoform X1
14	61622.XP_010355434.1	0.580	TBC1 domain family member 7 isoform X1
15	61622.XP_010361686.1	0.571	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha isoform X1
16	61622.XP_010368093.1	0.571	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
17	61622.XP_010369015.1	0.563	DnaJ heat shock protein family (Hsp40) member C6
18	61622.XP_010371849.1	0.554	TBC1 domain family member 8B isoform X1
19	61622.XP_010381569.1	0.551	TBC1 domain family member 21 isoform X1
20	61622.XP_010371595.1	0.549	Small G protein signaling modulator 1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030234	0.312	enzyme regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.762	biological regulation
GO:0050789	0.547	regulation of biological process
GO:0032501	0.489	multicellular organismal process
GO:0050794	0.464	regulation of cellular process
GO:0009987	0.435	cellular process
GO:0051179	0.387	localization
GO:0003008	0.301	system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.996	intracellular anatomical structure
GO:0005737	0.993	cytoplasm
GO:0016020	0.971	membrane
GO:0043226	0.968	organelle
GO:0005829	0.964	cytosol
GO:0043231	0.953	intracellular membrane-bounded organelle
GO:0012505	0.611	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]