StarFunc result for job id Q6ZT12

User Input

>input (1888 residues)
MAAAAAAAVGGQQPSQPELPAPGLALDKAATAAHLKAALSRPDNRAGAEELQALLERVLS
AERPLAAAAGGEDAAAAGGGGGPGAAEEEALEWCKCLLAGGGGYDEFCAAVRAYDPAALC
GLVWTANFVAYRCRTCGISPCMSLCAECFHQGDHTGHDFNMFRSQAGGACDCGDSNVMRE
SGFCKRHQIKSSSNIPCVPKDLLMMSEFVLPRFIFCLIQYLREGYNEPAADGPSEKDLNK
VLQLLEPQISFLEDLTKMGGAMRSVLTQVLTNQQNYKDLTSGLGENACVKKSHEKYLIAL
KSSGLTYPEDKLVYGVQEPSAGTSSLAVQGFIGATGTLGQVDSSDEDDQDGSQGLGKRKR
VKLSSGTKDQSIMDVLKHKSFLEELLFWTIKYEFPQKMVTFLLNMLPDQEYKVAFTKTFV
QHYAFIMKTLKKSHESDTMSNRIVHISVQLFSNEELARQVTEECQLLDIMVTVLLYMMES
CLIKSELQDEENSLHVVVNCGEALLKNNTYWPLVSDFINILSHQSVAKRFLEDHGLLVTW
MNFVSFFQGMNLNKRELNEHVEFESQTYYAAFAAELEACAQPMWGLLSHCKVRETQEYTR
NVVRYCLEALQDWFDAINFVDEPAPNQVTFHLPLHRYYAMFLSKAVKCQELDLDSVLPDQ
EMLMKLMIHPLQIQASLAEIHSNMWVRNGLQIKGQAMTYVQSHFCNSMIDPDIYLLQVCA
SRLDPDYFISSVFERFKVVDLLTMASQHQNTVLDAEHERSMLEGALTFLVILLSLRLHLG
MSDDEILRAEMVAQLCMNDRTHSSLLDLIPENPNPKSGIIPGSYSFESVLSAVADFKAPV
FEPGGSMQQGMYTPKAEVWDQEFDPVMVILRTVYRRDVQSAMDRYTAFLKQSGKFPGNPW
PPYKKRTSLHPSYKGLMRLLHCKTLHIVLFTLLYKILMDHQNLSEHVLCMVLYLIELGLE
NSAEEESDEEASVGGPERCHDSWFPGSNLVSNMRHFINYVRVRVPETAPEVKRDSPASTS
SDNLGSLQNSGTAQVFSLVAERRKKFQEIINRSSSEANQVVRPKTSSKWSAPGSAPQLTT
AILEIKESILSLLIKLHHKLSGKQNSYYPPWLDDIEILIQPEIPKYSHGDGITAVERILL
KAASQSRMNKRIIEEICRKVTPPVPPKKVTAAEKKTLDKEERRQKARERQQKLLAEFASR
QKSFMETAMDVDSPENDIPMEITTAEPQVSEAVYDCVICGQSGPSSEDRPTGLVVLLQAS
SVLGQCRDNVEPKKLPISEEEQIYPWDTCAAVHDVRLSLLQRYFKDSSCLLAVSIGWEGG
VYVQTCGHTLHIDCHKSYMESLRNDQVLQGFSVDKGEFTCPLCRQFANSVLPCYPGSNVE
NNPWQRPSNKSIQDLIKEVEELQGRPGAFPSETNLSKEMESVMKDIKNTTQKKYRDYSKT
PGSPDNDFLFMYSVARTNLELELIHRGGNLCSGGASTAGKRSCLNQLFHVLALHMRLYSI
DSEYNPWRKLTQLEEMNPQLGYEEQQPEVPILYHDVTSLLLIQILMMPQPLRKDHFTCIV
KVLFTLLYTQALAALSVKCSEEDRSAWKHAGALKKSTCDAEKSYEVLLSFVISELFKGKL
YHEEGTQECAMVNPIAWSPESMEKCLQDFCLPFLRITSLLQHHLFGEDLPSCQEEEEFSV
LASCLGLLPTFYQTEHPFISASCLDWPVPAFDIITQWCFEIKSFTERHAEQGKALLIQES
KWKLPHLLQLPENYNTIFQYYHRKTCSVCTKVPKDPAVCLVCGTFVCLKGLCCKQQSYCE
CVLHSQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGKPLYICKE
RYKVLEQQWISHTFDHINKRWGPHYNGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A7F0	0.864	0.863	0.000	1890	0.952	0.951	D4A7F0.pdb.gz	D4A7F0_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Ubr3 PE=1 SV=4
2	AFDB:F1QJX5	0.923	0.935	0.000	1863	0.727	0.737	F1QJX5.pdb.gz	UBR3_DANRE E3 ubiquitin-protein ligase ubr3 OS=Danio rerio OX=7955 GN=ubr3 PE=2 SV=2
3	AFDB:Q9W3M3	0.792	0.678	0.000	2219	0.361	0.307	Q9W3M3.pdb.gz	UBR3_DROME E3 ubiquitin-protein ligase Ubr3 OS=Drosophila melanogaster OX=7227 GN=Ubr3 PE=1 SV=4
4	AFDB:F4KCC2	0.626	0.592	7.311E-59	2006	0.216	0.203	F4KCC2.pdb.gz	PRT6_ARATH E3 ubiquitin-protein ligase PRT6 OS=Arabidopsis thaliana OX=3702 GN=PRT6 PE=1 SV=1
5	AFDB:O70481	0.611	0.653	4.981E-55	1757	0.198	0.212	O70481.pdb.gz	UBR1_MOUSE E3 ubiquitin-protein ligase UBR1 OS=Mus musculus OX=10090 GN=Ubr1 PE=1 SV=2
6	AFDB:Q6WKZ8	0.605	0.646	3.965E-54	1755	0.191	0.206	Q6WKZ8.pdb.gz	UBR2_MOUSE E3 ubiquitin-protein ligase UBR2 OS=Mus musculus OX=10090 GN=Ubr2 PE=1 SV=2
7	AFDB:O13731	0.589	0.547	3.003E-51	2052	0.190	0.174	O13731.pdb.gz	UBR11_SCHPO E3 ubiquitin-protein ligase ubr11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubr11 PE=1 SV=1
8	AFDB:O60152	0.583	0.564	9.770E-51	1958	0.192	0.185	O60152.pdb.gz	UBR1_SCHPO E3 ubiquitin-protein ligase ubr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubr1 PE=3 SV=1
9	AFDB:P91133	0.571	0.530	1.886E-47	2058	0.183	0.168	P91133.pdb.gz	UBR1_CAEEL E3 ubiquitin-protein ligase ubr-1 OS=Caenorhabditis elegans OX=6239 GN=ubr-1 PE=1 SV=2
10	AFDB:Q07963	0.555	0.559	1.690E-36	1872	0.156	0.157	Q07963.pdb.gz	UBR2_YEAST E3 ubiquitin-protein ligase UBR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBR2 PE=1 SV=1
11	PDB:7mexA	0.565	0.609	9.331E-34	1737	0.149	0.162	7mexA.pdb.gz	Structural insights into Ubr1-mediated N-degron polyubiquitination.
12	PDB:7mopA	0.101	0.088	3.711E-5	2445	0.101	0.078	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
13	PDB:7wttK	0.071	0.103	3.476E-4	1022	0.044	0.082	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
14	PDB:2xwuB	0.086	0.131	3.771E-4	910	0.054	0.112	2xwuB.pdb.gz
15	PDB:3gjxA	0.098	0.143	6.143E-4	1041	0.048	0.087	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
16	PDB:3opbA	0.080	0.136	8.859E-4	747	0.044	0.111	3opbA.pdb.gz
17	PDB:3w3zA	0.081	0.128	9.610E-4	1013	0.045	0.084	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
18	PDB:4c0qA	0.076	0.112	1.086E-3	871	0.050	0.109	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
19	PDB:6ahoA	0.081	0.132	1.086E-3	916	0.062	0.128	6ahoA.pdb.gz
20	PDB:7w7gB	0.084	0.088	1.086E-3	1711	0.083	0.091	7w7gB.pdb.gz	Structure and mechanism of NALCN-FAM155A-UNC79-UNC80 channel complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A7F0	0.0	3667	1889	0.948	0.948	D4A7F0_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Ubr3 PE=1 SV=4
2	F1QJX5	0.0	2796	1863	0.729	0.739	UBR3_DANRE E3 ubiquitin-protein ligase ubr3 OS=Danio rerio OX=7955 GN=ubr3 PE=2 SV=2
3	M9PDZ8	0.0	668	2236	0.198	0.167	M9PDZ8_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=Ubr3 PE=1 SV=1
4	Q5U430	0.0	3675	1889	0.944	0.943	UBR3_MOUSE E3 ubiquitin-protein ligase UBR3 OS=Mus musculus OX=10090 GN=Ubr3 PE=1 SV=3
5	Q9W3M3	0.0	668	2219	0.198	0.169	UBR3_DROME E3 ubiquitin-protein ligase Ubr3 OS=Drosophila melanogaster OX=7227 GN=Ubr3 PE=1 SV=4
6	Q6WKZ8	1.24e-36	154	1755	0.117	0.125	UBR2_MOUSE E3 ubiquitin-protein ligase UBR2 OS=Mus musculus OX=10090 GN=Ubr2 PE=1 SV=2
7	Q8IWV8	9.57e-34	145	1755	0.102	0.110	UBR2_HUMAN E3 ubiquitin-protein ligase UBR2 OS=Homo sapiens OX=9606 GN=UBR2 PE=1 SV=1
8	O70481	7.03e-26	119	1757	0.077	0.083	UBR1_MOUSE E3 ubiquitin-protein ligase UBR1 OS=Mus musculus OX=10090 GN=Ubr1 PE=1 SV=2
9	Q8IWV7	1.37e-25	118	1749	0.075	0.081	UBR1_HUMAN E3 ubiquitin-protein ligase UBR1 OS=Homo sapiens OX=9606 GN=UBR1 PE=1 SV=1
10	O13731	1.24e-22	108	2052	0.066	0.061	UBR11_SCHPO E3 ubiquitin-protein ligase ubr11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubr11 PE=1 SV=1
11	F4KCC2	1.35e-21	105	2006	0.030	0.028	PRT6_ARATH E3 ubiquitin-protein ligase PRT6 OS=Arabidopsis thaliana OX=3702 GN=PRT6 PE=1 SV=1
12	O60152	5.92e-20	100	1958	0.036	0.035	UBR1_SCHPO E3 ubiquitin-protein ligase ubr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubr1 PE=3 SV=1
13	P91133	3.18e-15	84.7	2058	0.023	0.021	UBR1_CAEEL E3 ubiquitin-protein ligase ubr-1 OS=Caenorhabditis elegans OX=6239 GN=ubr-1 PE=1 SV=2
14	Q07963	7.40e-09	63.5	1872	0.041	0.042	UBR2_YEAST E3 ubiquitin-protein ligase UBR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBR2 PE=1 SV=1
15	A0A1D8PLP8	2.85e-06	55.1	1787	0.014	0.015	A0A1D8PLP8_CANAL E3 ubiquitin-protein ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBR1 PE=3 SV=1
16	P19812	2.04e-05	52.4	1950	0.030	0.029	UBR1_YEAST E3 ubiquitin-protein ligase UBR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBR1 PE=1 SV=1
17	Q62671	0.003	45.1	2788	0.025	0.017	UBR5_RAT E3 ubiquitin-protein ligase UBR5 OS=Rattus norvegicus OX=10116 GN=Ubr5 PE=1 SV=3
18	Q80TP3	0.008	43.9	2792	0.025	0.017	UBR5_MOUSE E3 ubiquitin-protein ligase UBR5 OS=Mus musculus OX=10090 GN=Ubr5 PE=1 SV=2
19	E7EMW7	0.024	42.4	2792	0.011	0.007	E7EMW7_HUMAN Ubiquitin protein ligase E3 component n-recognin 5 OS=Homo sapiens OX=9606 GN=UBR5 PE=1 SV=1
20	O95071	0.024	42.4	2799	0.011	0.007	UBR5_HUMAN E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00650 CRAL_TRIO	42	15.4	CRAL/TRIO domain
2	PF18995 PRT6_C	6.4e-69	244.6	Proteolysis_6 C-terminal
3	PF00097 zf-C3HC4	68	14.8	Zinc finger, C3HC4 type (RING finger)
4	PF02207 zf-UBR	6.9e-14	63.0	Putative zinc finger in N-recognin (UBR box)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000396068

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382269	0.856	E3 ubiquitin-protein ligase HECTD1
2	9606.ENSP00000376808	0.827	Cullin-5
3	9606.ENSP00000360613	0.802	Ubiquitin-conjugating enzyme E2 A
4	9606.ENSP00000013070	0.801	Putative E3 ubiquitin-protein ligase UBR7
5	9606.ENSP00000265339	0.786	Ubiquitin-conjugating enzyme E2 B
6	9606.ENSP00000364403	0.728	E3 ubiquitin-protein ligase UBR4
7	9606.ENSP00000291670	0.679	Formimidoyltransferase-cyclodeaminase
8	9606.ENSP00000384823	0.675	F-box only protein 11
9	9606.ENSP00000429084	0.657	E3 ubiquitin-protein ligase UBR5
10	9606.ENSP00000363068	0.653	Protocadherin-15
11	9606.ENSP00000364430	0.630	Transcription factor Sp5
12	9606.ENSP00000224652	0.608	Arginyl-tRNA--protein transferase 1
13	9606.ENSP00000349543	0.593	Peroxisome biogenesis factor 2
14	9606.ENSP00000364621	0.570	Sushi domain-containing protein 3
15	9606.ENSP00000386331	0.548	Unconventional myosin-VIIa
16	9606.ENSP00000252050	0.539	Cullin-9
17	9606.ENSP00000354201	0.537	Ubiquitin-conjugating enzyme E2 Z
18	9606.ENSP00000216714	0.522	DNA-(apurinic or apyrimidinic site) lyase
19	9606.ENSP00000262394	0.521	WD repeat and SOCS box-containing protein 1
20	9606.ENSP00000310686	0.506	F-box/WD repeat-containing protein 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0043167	0.342	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.972	organic substance metabolic process
GO:0044238	0.969	primary metabolic process
GO:0050794	0.957	regulation of cellular process
GO:0009987	0.948	cellular process
GO:0043632	0.920	modification-dependent macromolecule catabolic process
GO:0006807	0.917	nitrogen compound metabolic process
GO:0051603	0.910	proteolysis involved in protein catabolic process
GO:0050896	0.814	response to stimulus
GO:0019222	0.808	regulation of metabolic process
GO:0048518	0.777	positive regulation of biological process
GO:0060255	0.705	regulation of macromolecule metabolic process
GO:0080090	0.686	regulation of primary metabolic process
GO:0051171	0.680	regulation of nitrogen compound metabolic process
GO:0032501	0.645	multicellular organismal process
GO:0003008	0.643	system process
GO:0048856	0.627	anatomical structure development
GO:0019941	0.623	modification-dependent protein catabolic process
GO:0042221	0.611	response to chemical
GO:0009894	0.605	regulation of catabolic process
GO:0007275	0.604	multicellular organism development
GO:0050877	0.596	nervous system process
GO:0007610	0.572	behavior
GO:0006511	0.571	ubiquitin-dependent protein catabolic process
GO:0051246	0.549	regulation of protein metabolic process
GO:0048519	0.523	negative regulation of biological process
GO:0007635	0.506	chemosensory behavior
GO:0043412	0.496	macromolecule modification
GO:0048523	0.477	negative regulation of cellular process
GO:0009893	0.450	positive regulation of metabolic process
GO:0032879	0.417	regulation of localization
GO:0048522	0.415	positive regulation of cellular process
GO:0036211	0.385	protein modification process
GO:0010604	0.374	positive regulation of macromolecule metabolic process
GO:0070647	0.353	protein modification by small protein conjugation or removal
GO:0051173	0.334	positive regulation of nitrogen compound metabolic process
GO:0051247	0.303	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.900	protein-containing complex
GO:0043227	0.817	membrane-bounded organelle
GO:0043231	0.800	intracellular membrane-bounded organelle
GO:0016020	0.767	membrane
GO:0005634	0.689	nucleus
GO:1902494	0.572	catalytic complex
GO:0031981	0.363	nuclear lumen
GO:0005654	0.331	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]