StarFunc result for job id Q6ZT21

User Input

>input (453 residues)
MAIFRQLSLGAKATLAAVTVFVSMIASRSYLAESLELRAWRWLLRLQLALFVNSLLLIGS
LYIWRSTVSNLCHSPAAESTCFQLWKVVVLAFLALAHSSFFTMFFLVAEEPYLFSLAAYS
CLGAYIIMLFFLFILSGMEQAYQLLAWRSGRVVGSLEKTRKLVLRPALAVGVTAVLSVAG
ILNAAQPPAVKTVEVPIHQLPASMNNLKIVLLSDIHLGPTVGRTKMEMFVRMVNVLEPDI
TVIVGDLSDSEASVLRTAVAPLGQLHSHLGAYFVTGNHEYYTSDVSNWFALLESLHVQPL
HNENVKISATRAQRGGGGSGSGSEDEDWICLAGVDDIEADILHYSGHGMDLDKALEGCSP
DHTIILLAHQPLAAKRALQARPDINLILSGHTHAGQIFPLNVAAYLLNPFFAGLYQVAQA
TFVYVSPGTAYYGIPMRLGSRAEITELILQRSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZT21	1.000	1.000	2.773E-85	453	1.000	1.000	Q6ZT21.pdb.gz	TMPPE_HUMAN Transmembrane protein with metallophosphoesterase domain OS=Homo sapiens OX=9606 GN=TMPPE PE=1 SV=2
2	AFDB:P37049	0.500	0.810	2.850E-15	270	0.128	0.215	P37049.pdb.gz	YAEI_ECOLI Phosphodiesterase YaeI OS=Escherichia coli (strain K12) OX=83333 GN=yaeI PE=3 SV=2
3	AFDB:O84467	0.508	0.688	3.343E-15	329	0.174	0.240	O84467.pdb.gz	LPXG_CHLTR UDP-2,3-diacylglucosamine pyrophosphatase LpxG OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=lpxG PE=1 SV=1
4	AFDB:Q55D82	0.476	0.598	3.857E-14	353	0.157	0.201	Q55D82.pdb.gz	Q55D82_DICDI Calcineurin-like phosphoesterase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269754 PE=4 SV=1
5	AFDB:O69651	0.440	0.598	1.745E-11	319	0.163	0.232	O69651.pdb.gz	O69651_MYCTO Calcineurin-like phosphoesterase domain-containing protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3785 PE=3 SV=1
6	PDB:2bq8X	0.286	0.407	1.114E-5	304	0.079	0.118	2bq8X.pdb.gz	Crystal Structures of Recombinant Human Purple Acid Phosphatase with and without an Inhibitory Conformation of the Repression Loop.
7	PDB:7jv8C	0.320	0.280	3.227E-5	529	0.093	0.079	7jv8C.pdb.gz	Orally Bioavailable Small-Molecule CD73 Inhibitor (OP-5244) Reverses Immunosuppression through Blockade of Adenosine Production.
8	PDB:3thoB	0.282	0.338	3.589E-5	366	0.082	0.101	3thoB.pdb.gz	ATP driven structural changes of the bacterial Mre11:Rad50 catalytic head complex.
9	PDB:3rl5A	0.329	0.506	3.530E-4	279	0.093	0.151	3rl5A.pdb.gz	Unique utilization of a phosphoprotein phosphatase fold by a mammalian phosphodiesterase associated with WAGR syndrome.
10	PDB:3av0A	0.304	0.366	4.367E-4	369	0.102	0.125	3av0A.pdb.gz	Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
11	AFDB:Q7ZUB6	0.299	0.437	4.754E-4	294	0.093	0.143	Q7ZUB6.pdb.gz	Q7ZUB6_DANRE Fetal brain protein 239 OS=Danio rerio OX=7955 GN=brpl PE=2 SV=1
12	AFDB:B1WBP0	0.304	0.447	5.881E-4	294	0.095	0.146	B1WBP0.pdb.gz	MPPD2_RAT Metallophosphoesterase MPPED2 OS=Rattus norvegicus OX=10116 GN=Mpped2 PE=1 SV=1
13	PDB:3ib7A	0.303	0.429	7.047E-4	295	0.121	0.186	3ib7A.pdb.gz	A mycobacterial cyclic AMP phosphodiesterase that moonlights as a modifier of cell wall permeability
14	PDB:6s6vA	0.267	0.307	7.838E-4	386	0.088	0.104	6s6vA.pdb.gz	Mechanism of DNA End Sensing and Processing by the Mre11-Rad50 Complex.
15	AFDB:O15442	0.309	0.410	1.113E-3	326	0.086	0.120	O15442.pdb.gz	MPPD1_HUMAN Metallophosphoesterase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MPPED1 PE=1 SV=3
16	PDB:2nxfA	0.332	0.460	3.123E-3	314	0.082	0.118	2nxfA.pdb.gz	Crystal Structure of a dimetal phosphatase from Danio rerio LOC 393393
17	PDB:5k78B	0.302	0.375	3.863E-3	351	0.091	0.117	5k78B.pdb.gz	The RNA lariat debranching enzyme Dbr1: metal dependence and branched RNA co-crystal structures
18	AFDB:Q9VRQ7	0.236	0.208	4.205E-3	525	0.079	0.069	Q9VRQ7.pdb.gz	DPOE2_DROME DNA polymerase epsilon subunit 2 OS=Drosophila melanogaster OX=7227 GN=PolE2 PE=1 SV=1
19	AFDB:Q22306	0.250	0.282	4.677E-3	396	0.073	0.083	Q22306.pdb.gz	YW12_CAEEL UPF0046 protein T07D4.2 OS=Caenorhabditis elegans OX=6239 GN=T07D4.2 PE=1 SV=3
20	PDB:6s85B	0.270	0.331	8.576E-3	356	0.102	0.129	6s85B.pdb.gz	Mechanism of DNA End Sensing and Processing by the Mre11-Rad50 Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZT21	0.0	923	453	1.000	1.000	TMPPE_HUMAN Transmembrane protein with metallophosphoesterase domain OS=Homo sapiens OX=9606 GN=TMPPE PE=1 SV=2
2	Q55D82	5.00e-09	60.1	353	0.143	0.184	Q55D82_DICDI Calcineurin-like phosphoesterase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269754 PE=4 SV=1
3	O84467	9.80e-06	49.7	329	0.119	0.164	LPXG_CHLTR UDP-2,3-diacylglucosamine pyrophosphatase LpxG OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=lpxG PE=1 SV=1
4	O69651	0.038	38.5	319	0.124	0.176	O69651_MYCTO Calcineurin-like phosphoesterase domain-containing protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3785 PE=3 SV=1
5	P37049	2.5	32.7	270	0.068	0.115	YAEI_ECOLI Phosphodiesterase YaeI OS=Escherichia coli (strain K12) OX=83333 GN=yaeI PE=3 SV=2
6	Q12212	4.0	32.3	622	0.055	0.040	SIA1_YEAST Protein SIA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIA1 PE=2 SV=1
7	Q05924	4.9	32.0	578	0.071	0.055	DCR2_YEAST Phosphatase DCR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCR2 PE=1 SV=1
8	Q54IF7	9.6	30.4	183	0.031	0.077	VPS29_DICDI Vacuolar protein sorting-associated protein 29 OS=Dictyostelium discoideum OX=44689 GN=vps29 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00149 Metallophos	1.2e-07	44.0	Calcineurin-like phosphoesterase
2	PF12850 Metallophos_2	0.33	22.5	Calcineurin-like phosphoesterase superfamily domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343398

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301037	0.729	Uncharacterized serine/threonine-protein kinase SgK494
2	9606.ENSP00000299237	0.679	Zinc finger protein 319
3	9606.ENSP00000380921	0.610	SH3 domain-containing kinase-binding protein 1
4	9606.ENSP00000287474	0.586	Ferric-chelate reductase 1
5	9606.ENSP00000377055	0.542	Lysosomal Pro-X carboxypeptidase
6	9606.ENSP00000306920	0.501	Beta-galactosidase
7	9606.ENSP00000373937	0.501	Protogenin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.880	catalytic activity
GO:0016787	0.770	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006643	0.996	membrane lipid metabolic process
GO:0006807	0.870	nitrogen compound metabolic process
GO:0006796	0.766	phosphate-containing compound metabolic process
GO:1901576	0.706	organic substance biosynthetic process
GO:0044249	0.706	cellular biosynthetic process
GO:0065007	0.705	biological regulation
GO:1901564	0.669	organonitrogen compound metabolic process
GO:1901135	0.653	carbohydrate derivative metabolic process
GO:0019637	0.624	organophosphate metabolic process
GO:0050789	0.559	regulation of biological process
GO:0050794	0.531	regulation of cellular process
GO:0046467	0.426	membrane lipid biosynthetic process
GO:1901137	0.359	carbohydrate derivative biosynthetic process
GO:0006644	0.330	phospholipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.997	cytoplasm
GO:0012505	0.985	endomembrane system
GO:0016020	0.960	membrane
GO:0031090	0.807	organelle membrane
GO:0070013	0.644	intracellular organelle lumen
GO:0005783	0.634	endoplasmic reticulum
GO:0005634	0.623	nucleus
GO:0031981	0.365	nuclear lumen
GO:0071944	0.316	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.770	Hydrolases.

[back to server]