StarFunc result for job id Q6ZTA4

User Input

>input (783 residues)
MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPQPLLLSRGSGLQAG
AAAAASLEHDAAAGPACGGAGGSAAGGLGGGAGGGGDHADKLSLYSETDSGYGSYTPSLK
SPNGVRVLPMVPAPPGSSAAAARGAACSSLSSSSSSITCPQCHRSASLDHRGLRGFQRNR
LLEAIVQRYQQGRGAVPGTSAAAAVAICQLCDRTPPEPAATLCEQCDVLYCSACQLKCHP
SRGPFAKHRLVQPPPPPPPPAEAASGPTGTAQGAPSGGGGCKSPGGAGAGATGGSTARKF
PTCPEHEMENYSMYCVSCRTPVCYLCLEEGRHAKHEVKPLGAMWKQHKAQLSQALNGVSD
KAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKL
KMVWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGALE
PKVSAEFDLTLDSEPLLQAIHQLDFIQMKCRVPPVPLLQLEKCCTRNNSVTLAWRMPPFT
HSPVDGYILELDDGAGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTV
VLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRY
DNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVG
VLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLEVPTNLGRPKL
SGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q505D9	0.404	0.411	0.000	768	0.916	0.934	Q505D9.pdb.gz	TRI67_MOUSE Tripartite motif-containing protein 67 OS=Mus musculus OX=10090 GN=Trim67 PE=2 SV=1
2	AFDB:M9MRI4	0.358	0.377	2.565E-74	740	0.398	0.422	M9MRI4.pdb.gz	TRIM9_DROME E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1
3	AFDB:Q9UAQ3	0.353	0.360	9.366E-67	765	0.361	0.370	Q9UAQ3.pdb.gz	Q9UAQ3_CAEEL E3 ubiquitin-protein ligase TRIM9 OS=Caenorhabditis elegans OX=6239 GN=madd-2 PE=4 SV=2
4	AFDB:Q9UJV3	0.361	0.381	2.045E-42	735	0.240	0.256	Q9UJV3.pdb.gz	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
5	AFDB:O70583	0.349	0.390	5.667E-41	680	0.239	0.275	O70583.pdb.gz	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
6	AFDB:Q80WG7	0.281	0.298	6.673E-39	729	0.215	0.230	Q80WG7.pdb.gz	TRI36_MOUSE E3 ubiquitin-protein ligase Trim36 OS=Mus musculus OX=10090 GN=Trim36 PE=1 SV=2
7	AFDB:A1L4K1	0.221	0.230	3.201E-27	749	0.184	0.192	A1L4K1.pdb.gz	FSD2_HUMAN Fibronectin type III and SPRY domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FSD2 PE=1 SV=1
8	AFDB:Q8BZ52	0.241	0.261	2.729E-26	716	0.152	0.166	Q8BZ52.pdb.gz	FSD2_MOUSE Fibronectin type III and SPRY domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fsd2 PE=1 SV=3
9	AFDB:Q14142	0.237	0.408	1.796E-18	442	0.121	0.215	Q14142.pdb.gz	TRI14_HUMAN Tripartite motif-containing protein 14 OS=Homo sapiens OX=9606 GN=TRIM14 PE=1 SV=2
10	AFDB:E7FAM5	0.280	0.268	2.225E-18	824	0.142	0.135	E7FAM5.pdb.gz	LIN41_DANRE E3 ubiquitin-protein ligase TRIM71 OS=Danio rerio OX=7955 GN=trim71 PE=1 SV=1
11	PDB:7y4sA	0.177	0.383	2.713E-10	343	0.075	0.172	7y4sA.pdb.gz
12	PDB:7ccbA	0.177	0.795	7.509E-10	164	0.037	0.177	7ccbA.pdb.gz
13	PDB:7nscA	0.192	0.525	7.933E-9	276	0.038	0.109	7nscA.pdb.gz
14	PDB:4b3nA	0.173	0.238	5.174E-8	557	0.041	0.057	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
15	PDB:6swy1	0.158	0.222	2.198E-7	542	0.031	0.044	6swy1.pdb.gz
16	PDB:7m6aA	0.154	0.029	5.466E-7	4306	0.046	0.008	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
17	PDB:7tzcA	0.143	0.026	6.419E-7	4404	0.040	0.007	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
18	PDB:7ua3A	0.153	0.028	7.538E-7	4443	0.046	0.008	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
19	PDB:5t15B	0.143	0.029	9.340E-7	4170	0.043	0.008	5t15B.pdb.gz	Structural Basis for Gating and Activation of RyR1.
20	PDB:7u9tA	0.148	0.028	1.777E-6	4229	0.045	0.008	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q505D9	0.0	1340	768	0.920	0.938	TRI67_MOUSE Tripartite motif-containing protein 67 OS=Mus musculus OX=10090 GN=Trim67 PE=2 SV=1
2	Q8C7M3	0.0	685	817	0.453	0.435	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
3	Q91ZY8	0.0	982	710	0.627	0.692	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
4	Q9C026	0.0	993	710	0.628	0.693	TRIM9_HUMAN E3 ubiquitin-protein ligase TRIM9 OS=Homo sapiens OX=9606 GN=TRIM9 PE=1 SV=1
5	M9MRI4	1.39e-180	537	740	0.368	0.389	TRIM9_DROME E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1
6	B1GRL4	2.14e-160	485	751	0.370	0.386	B1GRL4_CAEEL E3 ubiquitin-protein ligase TRIM9 OS=Caenorhabditis elegans OX=6239 GN=madd-2 PE=4 SV=1
7	Q9UAQ3	3.67e-159	483	765	0.372	0.380	Q9UAQ3_CAEEL E3 ubiquitin-protein ligase TRIM9 OS=Caenorhabditis elegans OX=6239 GN=madd-2 PE=4 SV=2
8	Q9UJV3	1.57e-49	188	735	0.218	0.233	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
9	O15344	5.56e-49	186	667	0.202	0.237	TRI18_HUMAN E3 ubiquitin-protein ligase Midline-1 OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
10	O70583	4.33e-46	177	680	0.204	0.235	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
11	Q9NQ86	1.40e-41	164	728	0.183	0.196	TRI36_HUMAN E3 ubiquitin-protein ligase TRIM36 OS=Homo sapiens OX=9606 GN=TRIM36 PE=1 SV=2
12	Q80WG7	3.20e-40	160	729	0.188	0.202	TRI36_MOUSE E3 ubiquitin-protein ligase Trim36 OS=Mus musculus OX=10090 GN=Trim36 PE=1 SV=2
13	Q7TNM2	4.25e-39	157	759	0.216	0.223	TRI46_MOUSE Tripartite motif-containing protein 46 OS=Mus musculus OX=10090 GN=Trim46 PE=1 SV=1
14	A0A0G2JXN2	4.40e-39	157	759	0.215	0.221	TRI46_RAT Tripartite motif-containing protein 46 OS=Rattus norvegicus OX=10116 GN=Trim46 PE=1 SV=2
15	C9J453	3.24e-38	151	483	0.149	0.242	C9J453_HUMAN RING-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
16	Q9BTV5	1.38e-21	101	496	0.158	0.250	FSD1_HUMAN Fibronectin type III and SPRY domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FSD1 PE=1 SV=1
17	Q9BYV2	1.06e-19	94.0	358	0.074	0.162	TRI54_HUMAN Tripartite motif-containing protein 54 OS=Homo sapiens OX=9606 GN=TRIM54 PE=1 SV=3
18	Q1LY10	1.75e-19	94.7	495	0.149	0.236	FSD1_DANRE Fibronectin type III and SPRY domain-containing protein 1 OS=Danio rerio OX=7955 GN=fsd1 PE=3 SV=1
19	Q91Z63	8.05e-19	91.3	351	0.075	0.168	TRI63_RAT E3 ubiquitin-protein ligase TRIM63 OS=Rattus norvegicus OX=10116 GN=Trim63 PE=2 SV=1
20	Q9ERP3	2.21e-18	90.1	366	0.072	0.153	TRI54_MOUSE Tripartite motif-containing protein 54 OS=Mus musculus OX=10090 GN=Trim54 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	3.8e-05	35.3	Fibronectin type III domain
2	PF13765 PRY	0.74	20.8	SPRY-associated domain
3	PF00622 SPRY	3.1e-08	45.1	SPRY domain
4	PF00643 zf-B_box	2.5e-07	42.0	B-box zinc finger
5	PF00097 zf-C3HC4	0.1	23.8	Zinc finger, C3HC4 type (RING finger)
6	PF13920 zf-C3HC4_3	0.037	25.2	Zinc finger, C3HC4 type (RING finger)
7	PF15227 zf-C3HC4_4	0.0092	27.4	zinc finger of C3HC4-type, RING
8	PF14634 zf-RING_5	3.1	19.2	zinc-RING finger domain
9	PF13445 zf-RING_UBOX	0.1	24.0	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355613

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000389140	0.835	Netrin receptor DCC
2	9606.ENSP00000341198	0.755	Neogenin
3	9606.ENSP00000355658	0.736	E3 ubiquitin-protein ligase TRIM17
4	9606.ENSP00000340297	0.689	Rho guanine nucleotide exchange factor 10
5	9606.ENSP00000263182	0.660	Gamma-butyrobetaine dioxygenase
6	9606.ENSP00000173229	0.651	Netrin-1
7	9606.ENSP00000376421	0.649	Protein sidekick-2
8	9606.ENSP00000355621	0.634	Tetratricopeptide repeat domain containing
9	9606.ENSP00000365147	0.613	EF-hand domain-containing protein D2
10	9606.ENSP00000295756	0.605	T-cell receptor-associated transmembrane adapter 1
11	9606.ENSP00000418259	0.605	ZFP57 zinc finger protein
12	9606.ENSP00000428698	0.598	Probable E3 ubiquitin-protein ligase RNF217
13	9606.ENSP00000335636	0.590	N-alpha-acetyltransferase 20
14	9606.ENSP00000357591	0.576	Trafficking protein particle complex subunit 3-like protein
15	9606.ENSP00000388684	0.567	Transmembrane protein 247
16	9606.ENSP00000483333	0.554	SKI family transcriptional corepressor 2
17	9606.ENSP00000355609	0.520	Uncharacterized protein C1orf131
18	9606.ENSP00000013070	0.517	Putative E3 ubiquitin-protein ligase UBR7
19	9606.ENSP00000362555	0.513	E3 ubiquitin-protein ligase RNF19B
20	9606.ENSP00000355599	0.508	Translin-associated protein X

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.955	cellular process
GO:0048519	0.870	negative regulation of biological process
GO:0048523	0.817	negative regulation of cellular process
GO:0048583	0.743	regulation of response to stimulus
GO:0048518	0.734	positive regulation of biological process
GO:0010646	0.716	regulation of cell communication
GO:0023051	0.669	regulation of signaling
GO:0051128	0.654	regulation of cellular component organization
GO:0009966	0.615	regulation of signal transduction
GO:0009894	0.611	regulation of catabolic process
GO:0060255	0.605	regulation of macromolecule metabolic process
GO:0031323	0.601	regulation of cellular metabolic process
GO:1902531	0.510	regulation of intracellular signal transduction
GO:0071704	0.487	organic substance metabolic process
GO:0044238	0.476	primary metabolic process
GO:0120035	0.475	regulation of plasma membrane bounded cell projection organization
GO:0051171	0.460	regulation of nitrogen compound metabolic process
GO:0080090	0.458	regulation of primary metabolic process
GO:0006807	0.438	nitrogen compound metabolic process
GO:0048522	0.438	positive regulation of cellular process
GO:0010975	0.362	regulation of neuron projection development
GO:0043170	0.329	macromolecule metabolic process
GO:0051056	0.329	regulation of small GTPase mediated signal transduction
GO:0051246	0.313	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.904	cytosol
GO:0043226	0.774	organelle
GO:0043229	0.762	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]