StarFunc result for job id Q6ZTI6

User Input

>input (216 residues)
MVGHLHLQGMEDSLKEQGREGLLDSPDSGLPPSPSPSPPFYSLAPGILDARAGGAGASSE
PPGPSEARAPPSQLPNPPASEMRPRMLPVFFGESIKVNPEPTHEIRCNSEVKYASEKHFQ
DKVFYAPVPTVTAYSETIVAAPNCTWRNYRSQLTLEPRPRALRFRSTTIIFPKHARSTFR
TTLHCSLGRPSRWFTASVQLQLCQDPAPSLLGPATL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZTI6	0.999	0.999	1.145E-33	216	1.000	1.000	Q6ZTI6.pdb.gz	RFLA_HUMAN Refilin-A OS=Homo sapiens OX=9606 GN=RFLNA PE=1 SV=3
2	AFDB:Q8N5W9	0.202	0.204	7.730E-9	214	0.370	0.374	Q8N5W9.pdb.gz	RFLB_HUMAN Refilin-B OS=Homo sapiens OX=9606 GN=RFLNB PE=1 SV=1
3	PDB:6qz90A	0.155	0.126	1.759E-1	291	0.046	0.034	6qz90A.pdb.gz
4	PDB:7bk0B	0.097	0.087	5.902E-1	250	0.056	0.048	7bk0B.pdb.gz
5	PDB:6uzbA	0.084	0.042	6.236E-1	562	0.028	0.011	6uzbA.pdb.gz	Atomic structures of anthrax toxin protective antigen channels bound to partially unfolded lethal and edema factors.
6	PDB:2k8pA	0.113	0.126	1.347	189	0.125	0.143	2k8pA.pdb.gz
7	AFDB:P32768	0.115	0.025	1.889	1537	0.162	0.023	P32768.pdb.gz	FLO1_YEAST Flocculation protein FLO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FLO1 PE=1 SV=4
8	PDB:1ecyA	0.112	0.154	2.336	142	0.056	0.085	1ecyA.pdb.gz	Crystal structure analyses of uncomplexed ecotin in two crystal forms: implications for its function and stability.
9	AFDB:Q9Y2G1	0.128	0.031	2.354	1151	0.181	0.034	Q9Y2G1.pdb.gz	MYRF_HUMAN Myelin regulatory factor OS=Homo sapiens OX=9606 GN=MYRF PE=1 SV=3
10	PDB:7cunG	0.096	0.030	2.608	895	0.037	0.009	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
11	AFDB:G5EFI7	0.089	0.026	2.776	931	0.176	0.041	G5EFI7.pdb.gz	MYRF1_CAEEL Myelin regulatory factor homolog 1 OS=Caenorhabditis elegans OX=6239 GN=myrf-1 PE=1 SV=1
12	PDB:2q2eB	0.108	0.044	2.911	581	0.042	0.015	2q2eB.pdb.gz
13	PDB:5jzwH	0.094	0.056	3.250	401	0.032	0.017	5jzwH.pdb.gz
14	AFDB:Q57Y57	0.136	0.080	3.459	389	0.153	0.085	Q57Y57.pdb.gz	Q57Y57_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.530 PE=4 SV=1
15	AFDB:P39712	0.094	0.023	3.655	1322	0.162	0.026	P39712.pdb.gz	FLO9_YEAST Flocculation protein FLO9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FLO9 PE=3 SV=2
16	PDB:1yycA	0.094	0.111	4.050	174	0.037	0.046	1yycA.pdb.gz
17	PDB:3fxiC	0.103	0.142	4.279	140	0.051	0.079	3fxiC.pdb.gz
18	AFDB:Q9FLQ4	0.124	0.066	4.555	464	0.116	0.054	Q9FLQ4.pdb.gz	ODO2A_ARATH Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g55070 PE=1 SV=1
19	AFDB:A0A0B4JD55	0.083	0.023	5.677	1292	0.171	0.029	A0A0B4JD55.pdb.gz	A0A0B4JD55_DROME Pou domain motif 3, isoform F OS=Drosophila melanogaster OX=7227 GN=pdm3 PE=4 SV=1
20	AFDB:Q57YV0	0.111	0.053	6.337	635	0.106	0.036	Q57YV0.pdb.gz	Q57YV0_TRYB2 NOT2/NOT3/NOT5 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.40 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZTI6	7.05e-159	439	216	1.000	1.000	RFLA_HUMAN Refilin-A OS=Homo sapiens OX=9606 GN=RFLNA PE=1 SV=3
2	Q7TS73	9.14e-92	269	204	0.690	0.730	RFLA_MOUSE Refilin-A OS=Mus musculus OX=10090 GN=Rflna PE=1 SV=1
3	Q5SVD0	1.52e-30	114	216	0.389	0.389	RFLB_MOUSE Refilin-B OS=Mus musculus OX=10090 GN=Rflnb PE=1 SV=1
4	Q8N5W9	1.30e-25	100	214	0.245	0.248	RFLB_HUMAN Refilin-B OS=Homo sapiens OX=9606 GN=RFLNB PE=1 SV=1
5	O35664	0.19	35.0	513	0.120	0.051	INAR2_MOUSE Interferon alpha/beta receptor 2 OS=Mus musculus OX=10090 GN=Ifnar2 PE=1 SV=2
6	P85120	1.1	32.7	2058	0.120	0.013	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
7	Q7KTX8	2.8	31.6	2618	0.074	0.006	MED13_DROME Mediator of RNA polymerase II transcription subunit 13 OS=Drosophila melanogaster OX=7227 GN=skd PE=1 SV=1
8	Q8I5B3	3.0	31.2	822	0.074	0.019	Q8I5B3_PLAF7 Protein transport protein SEC13 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1230700 PE=3 SV=1
9	Q5BFS3	6.0	30.4	4761	0.093	0.004	Q5BFS3_EMENI Ferricrocin synthetase (Nonribosomal peptide siderophore synthase ) (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00607 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15068 FAM101	1.3e-84	294.9	FAM101 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000049806

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000056469	0.682	Chromosome 17 open reading frame 67
2	9598.ENSPTRP00000009571	0.671	Transmembrane protein 132B
3	9598.ENSPTRP00000046337	0.659	Nuclear casein kinase and cyclin-dependent kinase substrate 1
4	9598.ENSPTRP00000052251	0.590	RNA binding protein, autoantigenic (HnRNP-associated with lethal yellow homolog )
5	9598.ENSPTRP00000029114	0.588	POC5 centriolar protein homolog
6	9598.ENSPTRP00000051234	0.545	Hexosyltransferase
7	9598.ENSPTRP00000042713	0.507	Belongs to the G-protein coupled receptor 2 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0048519	0.969	negative regulation of biological process
GO:0061035	0.958	regulation of cartilage development
GO:0048523	0.956	negative regulation of cellular process
GO:0007015	0.953	actin filament organization
GO:0032330	0.931	regulation of chondrocyte differentiation
GO:0007275	0.930	multicellular organism development
GO:0030279	0.928	negative regulation of ossification
GO:0048513	0.912	animal organ development
GO:0061572	0.897	actin filament bundle organization
GO:0070167	0.880	regulation of biomineral tissue development
GO:0030500	0.854	regulation of bone mineralization
GO:0060284	0.629	regulation of cell development
GO:0009653	0.595	anatomical structure morphogenesis
GO:0048731	0.583	system development
GO:0061181	0.483	regulation of chondrocyte development
GO:0009887	0.467	animal organ morphogenesis
GO:0051093	0.426	negative regulation of developmental process
GO:0001501	0.398	skeletal system development
GO:0048705	0.393	skeletal system morphogenesis
GO:0019222	0.315	regulation of metabolic process
GO:0031323	0.312	regulation of cellular metabolic process
GO:0045596	0.312	negative regulation of cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032432	0.996	actin filament bundle
GO:0043231	0.726	intracellular membrane-bounded organelle
GO:0005737	0.610	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]