StarFunc result for job id Q6ZTR5

User Input

>input (1400 residues)
MNTQKGSLTINVHRGSLAMSIQRGSLVPRDMDSSGRDMQLRVIPAEVKFLDTMAGRVYRL
PITVHNICRWNQKIRFKEPVKPQFKLMLTSLDKELASGLQMTAMVEYHPDKDEDTFDRLL
ISIENKTTEIPLIGLIPSCQLEIESVVNFGTLVANSKVYSKEITITNHGKAPGIFKAEYH
GQLPILIFPTSGIVDAKSSMVIKVDFCADQPRIVDEEAIVILQGQPEMLLSIKAHVVEQI
IELLSMSSDRRLECIHFGPVFFGSSKIKHARVYNNSPEPINWVAIIQDDAVGEELGTDIQ
QRTDIALNNLTYIRKIKNIDTTIIISCLPNEGTLQPYQKTVITFCFTPKLMAVGKKDIGP
SYRQDYALFLRFESVGSKDGFLRDDDYKTIKSERFQKVELALTGTGLPVLLQFDPGPVLN
FKPCFMGERSEIQCIIKNQCELLPVTYHFKKTANFEIDPEKGKITGGGMVDVMCSFVPHQ
LGVFKVKQMIEIIGLVAEEDLQSLSVKSFHHVYLAFNSICKASTKKVVMKFDPGILPSIR
NPTGKFVVKDLAKRKNYAPVAMLQSAMTRTHNHRSCEEPVKDMLLAFPNDRAATIRSKDH
HKHFRPIFTKVPRFNYVNHDFAYTTFEKQQKKLHENYYAMYLKYLRSVRLQKKQAERERM
YSYDDTDIGLEPGSGLKSPSLSEAEIEEELSSAANSIRANRLLTTRGIASQEEESVRRKV
LKGLKSEPSTPQEKHDCSLMLTPKQIHQVIVGPSVLNFGNICVNSPNTHLLHVINMLPMH
VLLQLDTDLEELQKTNQFSYVILPTSSTYISMVFDSPTIGKFWKSFTFTVNNVPSGHILV
VAVVQPVTLELSSNELVLRPRGFFMKTCFRGTVRLYNRQNCCAQFQWQPVNTGRGIAFSI
CPAKGTVEAYSSLECEVTWQQGFSSPEEGEFILHVFQGNALKLKCVAHLGRTKVLLLQPR
ILFSNCPQGLTTWRKAILQNVGQNHAYFKVCSQSLLPIINIIPSQGIVPFGGITVLNISC
KPTVAEKFDTRAKVSIRHANVIDLRIGGSAEIADVEINPDVFNFSGAYIGGTQIIPFVIK
NKGITRARVEFNLKDFPDFSMDLKDKSEEFKDPAVPYIYSLELEENTSLECSITFSPKEV
TVVEFIIQVQINFFESSKLYTKYLSSSPSNPKTVPLIRPCYVQATALQSPLNLSSTKFVF
EIPLHEMNPNNKVTKTQNLVLYNITKHHVTWTLDLSNTGKLFKDGTFKFSVLNGILRPNE
KYNVSISFCPNRPGTYTADIPMLLNYIPVCYKILHLTGEVKSPELLFDPPFIFFTPVPLD
ITTVMDINILPQNYFRNSTLCVQIPTVRLLDGEEIHPLSVKFPKGRVIPGSHSGINNKLT
CHLSFKSSKPVSFFTNLLFC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8JFU2	0.223	0.156	9.184E-68	2118	0.139	0.092	A8JFU2.pdb.gz	CFA65_CHLRE Cilia- and flagella-associated protein 65 (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP65 PE=1 SV=1
2	AFDB:Q3V0B4	0.204	0.161	1.701E-66	1847	0.147	0.112	Q3V0B4.pdb.gz	CFA65_MOUSE Cilia- and flagella-associated protein 65 OS=Mus musculus OX=10090 GN=Cfap65 PE=1 SV=1
3	AFDB:Q6ZU64	0.221	0.169	1.773E-65	1925	0.146	0.106	Q6ZU64.pdb.gz	CFA65_HUMAN Cilia- and flagella-associated protein 65 OS=Homo sapiens OX=9606 GN=CFAP65 PE=1 SV=2
4	AFDB:Q9Y238	0.227	0.187	5.831E-64	1755	0.144	0.115	Q9Y238.pdb.gz	DLEC1_HUMAN Deleted in lung and esophageal cancer protein 1 OS=Homo sapiens OX=9606 GN=DLEC1 PE=1 SV=2
5	AFDB:Q38AM8	0.223	0.180	4.563E-63	1794	0.142	0.111	Q38AM8.pdb.gz	Q38AM8_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3330 PE=4 SV=1
6	AFDB:Q57XV2	0.165	0.107	6.775E-49	2327	0.136	0.082	Q57XV2.pdb.gz	Q57XV2_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.1J15.770 PE=4 SV=1
7	AFDB:Q388P3	0.164	0.210	2.587E-48	1046	0.104	0.140	Q388P3.pdb.gz	Q388P3_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0270 PE=4 SV=1
8	PDB:7sqcO0	0.161	0.193	2.683E-47	1140	0.105	0.129	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
9	AFDB:D4P3R7	0.148	0.112	8.354E-44	1940	0.112	0.081	D4P3R7.pdb.gz	CFA74_CHLRE Cilia- and flagella-associated protein 74 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP74 PE=1 SV=1
10	AFDB:E9Q4Y4	0.113	0.077	1.113E-43	2514	0.097	0.054	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
11	AFDB:Q8TEP8	0.110	0.075	4.906E-43	2537	0.105	0.058	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
12	PDB:5a42A	0.084	0.077	1.685E-17	1597	0.079	0.070	5a42A.pdb.gz
13	PDB:7q1yA	0.101	0.103	1.675E-16	1374	0.065	0.066	7q1yA.pdb.gz
14	PDB:4lnvA	0.089	0.096	9.376E-16	1276	0.071	0.078	4lnvA.pdb.gz
15	PDB:7q5zA	0.095	0.098	1.032E-15	1344	0.069	0.072	7q5zA.pdb.gz
16	PDB:7vonA	0.099	0.099	2.561E-15	1399	0.070	0.070	7vonA.pdb.gz
17	PDB:6h03A	0.082	0.089	1.129E-14	1223	0.068	0.078	6h03A.pdb.gz
18	PDB:7sqcO1	0.149	0.281	1.129E-14	673	0.035	0.073	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:4ziqA	0.071	0.070	4.520E-14	1450	0.079	0.077	4ziqA.pdb.gz
20	PDB:4rtdA	0.085	0.100	1.425E-13	1122	0.048	0.060	4rtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JEB6	0.0	1895	3184	0.651	0.286	CFA47_MOUSE Cilia and flagella-associated protein 47 OS=Mus musculus OX=10090 GN=Cfap47 PE=1 SV=2
2	Q6ZTR5	0.0	2892	3187	1.000	0.439	CFA47_HUMAN Cilia- and flagella-associated protein 47 OS=Homo sapiens OX=9606 GN=CFAP47 PE=1 SV=5
3	Q583U1	5.07e-16	86.7	2728	0.132	0.068	Q583U1_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3D8.330 PE=4 SV=1
4	Q3V0B4	5.42e-05	50.4	1847	0.066	0.050	CFA65_MOUSE Cilia- and flagella-associated protein 65 OS=Mus musculus OX=10090 GN=Cfap65 PE=1 SV=1
5	Q80W93	0.002	45.1	5154	0.069	0.019	HYDIN_MOUSE Hydrocephalus-inducing protein OS=Mus musculus OX=10090 GN=Hydin PE=1 SV=2
6	Q388P3	0.044	40.8	1046	0.026	0.034	Q388P3_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0270 PE=4 SV=1
7	A8J6X7	0.057	40.4	645	0.030	0.065	PCDP1_CHLRE Cilia- and flagella-associated protein 221 homolog OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP221 PE=1 SV=1
8	Q583L9	0.25	38.5	4521	0.034	0.010	Q583L9_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.940 PE=4 SV=1
9	A9Q751	0.79	36.6	836	0.019	0.032	PCDP1_MOUSE Cilia- and flagella-associated protein 221 OS=Mus musculus OX=10090 GN=Cfap221 PE=1 SV=1
10	Q4G0P3	0.96	36.6	5121	0.049	0.013	HYDIN_HUMAN Hydrocephalus-inducing protein homolog OS=Homo sapiens OX=9606 GN=HYDIN PE=1 SV=3
11	D4P3R7	1.0	36.6	1940	0.016	0.012	CFA74_CHLRE Cilia- and flagella-associated protein 74 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP74 PE=1 SV=1
12	Q96D31	1.4	35.4	301	0.021	0.096	CRCM1_HUMAN Calcium release-activated calcium channel protein 1 OS=Homo sapiens OX=9606 GN=ORAI1 PE=1 SV=2
13	Q6IMI6	2.4	34.7	304	0.017	0.079	ST1C3_HUMAN Sulfotransferase 1C3 OS=Homo sapiens OX=9606 GN=SULT1C3 PE=1 SV=1
14	Q8I4D9	2.6	34.7	433	0.017	0.055	Q8I4D9_CAEEL Glutamate decarboxylase OS=Caenorhabditis elegans OX=6239 GN=unc-25 PE=1 SV=1
15	Q5M848	3.2	34.3	304	0.021	0.095	CRCM1_RAT Calcium release-activated calcium channel protein 1 OS=Rattus norvegicus OX=10116 GN=Orai1 PE=1 SV=1
16	G3V824	3.4	34.7	2481	0.011	0.006	G3V824_RAT Insulin-like growth factor 2 receptor OS=Rattus norvegicus OX=10116 GN=Igf2r PE=1 SV=1
17	A0A8I6AI55	3.5	34.7	2439	0.011	0.007	A0A8I6AI55_RAT Insulin-like growth factor 2 receptor OS=Rattus norvegicus OX=10116 GN=Igf2r PE=1 SV=1
18	A0A8I6GLL6	3.5	34.7	2479	0.011	0.006	A0A8I6GLL6_RAT Insulin-like growth factor 2 receptor OS=Rattus norvegicus OX=10116 GN=Igf2r PE=1 SV=1
19	G5EDB7	3.6	34.3	508	0.017	0.047	G5EDB7_CAEEL Glutamate decarboxylase 1 OS=Caenorhabditis elegans OX=6239 GN=unc-25 PE=1 SV=1
20	A8JFU2	4.0	34.7	2118	0.019	0.012	CFA65_CHLRE Cilia- and flagella-associated protein 65 (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP65 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15780 ASH	0.00023	32.6	Abnormal spindle-like microcephaly-assoc'd, ASPM-SPD-2-Hydin
2	PF09127 Leuk-A4-hydro_C	57	15.2	Leukotriene A4 hydrolase, C-terminal
3	PF00635 Motile_Sperm	0.008	27.4	MSP (Major sperm protein) domain
4	PF14874 PapD-like	12	17.5	Flagellar-associated PapD-like
5	PF12371 TMEM131_like_N	0.0046	28.5	Transmembrane protein 131-like N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9668.ENSMPUP00000000931

Rank	PPI partner	STRING score	Description
1	9668.ENSMPUP00000012312	0.563	Uncharacterized protein
2	9668.ENSMPUP00000016452	0.555	Cilia and flagella associated protein 65

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007281	0.988	germ cell development
GO:0120036	0.987	plasma membrane bounded cell projection organization
GO:0007010	0.987	cytoskeleton organization
GO:0007017	0.986	microtubule-based process
GO:0070925	0.986	organelle assembly
GO:0007288	0.975	sperm axoneme assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036126	1.000	sperm flagellum
GO:0005622	0.660	intracellular anatomical structure
GO:0005737	0.387	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]