StarFunc result for job id Q6ZTU2

User Input

>input (488 residues)
MQHVSSSQSSQRHVQWPGACPGAGEEQPACSQPSLPLTLPSPSHQLQQLMVRGGPAGGQN
MNVDLQGVGPGLQGSPQVTLAPLPLPSPTSPGFQFSAQPRRFEHGSPSYIQVTSPLSQQV
QTQSPTQPSPGPGQALQNVRAGAPGPGLGLCSSSPTGDFVDASVLVRQISLSPSSGGHFV
FQDGSGLTQIAQGAQVQLQHPGTPITVRERRPSQPHTQSGGTIHHLGPQSPAAAGGAGLQ
PLASPSHITTANLPPQISSIIQGQLVQQQQVLQGPPLPRPLGFERTPGVLLPGAGGAAGF
GMTSPPPPTSPSRTAVPPGLSSLPLTSVGNTGMKKVPKKLEEIPPASPEMAQMRKQCLDY
HHQEMQALKEVFKEYLIELFFLQHFQGNMMDFLAFKERLYGPLQAYLRQNDLDIEEEEEE
HFEVINDEVKVVARKHGQPGTPVAIATQLPPRTSAAFPAQQQPLQQIHMGTPVPGDVNSI
KMEASKRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0A0MR80	0.163	0.090	3.392E-43	985	0.852	0.422	A0A0A0MR80.pdb.gz	A0A0A0MR80_HUMAN E1A binding protein p400 OS=Homo sapiens OX=9606 GN=EP400 PE=1 SV=1
2	AFDB:Q96GE4	0.072	0.047	2.569E-3	821	0.150	0.089	Q96GE4.pdb.gz	CEP95_HUMAN Centrosomal protein of 95 kDa OS=Homo sapiens OX=9606 GN=CEP95 PE=1 SV=1
3	AFDB:Q86PA6	0.071	0.049	4.088E-3	744	0.225	0.148	Q86PA6.pdb.gz	Q86PA6_DROME LD29371p OS=Drosophila melanogaster OX=7227 GN=da PE=1 SV=1
4	AFDB:P34333	0.078	0.027	4.988E-3	1778	0.182	0.050	P34333.pdb.gz	NCOR1_CAEEL Nuclear receptor corepressor 1 OS=Caenorhabditis elegans OX=6239 GN=gei-8 PE=1 SV=4
5	AFDB:Q86SQ0	0.113	0.051	6.504E-3	1253	0.182	0.071	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
6	AFDB:O35451	0.078	0.055	9.063E-3	699	0.172	0.120	O35451.pdb.gz	ATF6B_MOUSE Cyclic AMP-dependent transcription factor ATF-6 beta OS=Mus musculus OX=10090 GN=Atf6b PE=1 SV=1
7	AFDB:P46889	0.070	0.031	1.263E-2	1329	0.162	0.059	P46889.pdb.gz	FTSK_ECOLI DNA translocase FtsK OS=Escherichia coli (strain K12) OX=83333 GN=ftsK PE=1 SV=2
8	AFDB:C9JFV4	0.088	0.043	1.442E-2	1180	0.174	0.072	C9JFV4.pdb.gz	C9JFV4_HUMAN Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2
9	AFDB:F1LWM1	0.060	0.036	1.647E-2	1032	0.148	0.070	F1LWM1.pdb.gz	F1LWM1_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh1 PE=1 SV=3
10	AFDB:Q8K1N2	0.093	0.049	2.009E-2	1249	0.160	0.062	Q8K1N2.pdb.gz	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2
11	PDB:7suk5	0.098	0.153	2.104	296	0.018	0.030	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
12	PDB:7mqaNA	0.071	0.107	4.985	295	0.055	0.092	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:6lss4	0.071	0.059	6.082	620	0.039	0.031	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
14	PDB:4j6sB	0.083	0.150	6.500	243	0.018	0.037	4j6sB.pdb.gz	The N-terminal sequence of tyrosine hydroxylase is a conformationally versatile motif that binds 14-3-3 proteins and membranes.
15	PDB:6vlzQ	0.054	0.103	6.500	240	0.029	0.058	6vlzQ.pdb.gz	Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
16	PDB:7wtwt	0.071	0.265	6.500	108	0.031	0.139	7wtwt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
17	PDB:7wtxt	0.069	0.221	6.500	132	0.029	0.106	7wtxt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
18	PDB:3otcA	0.097	0.162	7.931	264	0.018	0.034	3otcA.pdb.gz
19	PDB:6kxgC	0.076	0.087	8.475	419	0.027	0.031	6kxgC.pdb.gz
20	PDB:4fl2A	0.048	0.042	9.056	555	0.012	0.011	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MR80	0.0	644	985	0.846	0.419	A0A0A0MR80_HUMAN E1A binding protein p400 OS=Homo sapiens OX=9606 GN=EP400 PE=1 SV=1
2	A0A0G2JU09	0.0	627	3152	0.754	0.117	A0A0G2JU09_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
3	A0A8I5ZTE5	0.0	577	2998	0.682	0.111	A0A8I5ZTE5_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
4	A0A8I6G935	0.0	627	3146	0.754	0.117	A0A8I6G935_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
5	D3ZQ89	0.0	575	3034	0.682	0.110	D3ZQ89_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
6	Q8CHI8	0.0	629	3072	0.756	0.120	EP400_MOUSE E1A-binding protein p400 OS=Mus musculus OX=10090 GN=Ep400 PE=1 SV=3
7	Q96L91	0.0	651	3159	0.846	0.131	EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens OX=9606 GN=EP400 PE=1 SV=4
8	G5EBH3	0.16	37.4	3953	0.053	0.007	G5EBH3_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=sma-1 PE=1 SV=1
9	G5EC35	0.19	37.0	4063	0.053	0.006	G5EC35_CAEEL Beta chain spectrin homolog Sma1 OS=Caenorhabditis elegans OX=6239 GN=sma-1 PE=1 SV=1
10	G5EFW3	0.20	37.0	4166	0.053	0.006	G5EFW3_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=sma-1 PE=1 SV=1
11	G5EG97	0.20	37.0	3980	0.053	0.007	G5EG97_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=sma-1 PE=1 SV=1
12	Q9VAP9	6.8	32.0	2976	0.078	0.013	Q9VAP9_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Bicra PE=4 SV=2
13	A0A0B4KI51	7.1	32.0	3003	0.078	0.013	A0A0B4KI51_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Bicra PE=4 SV=1
14	Q8CFC9	7.6	31.6	601	0.076	0.062	LZTS1_RAT Leucine zipper putative tumor suppressor 1 OS=Rattus norvegicus OX=10116 GN=Lzts1 PE=1 SV=3
15	A0A0B4KI07	9.5	31.6	2684	0.078	0.014	A0A0B4KI07_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Bicra PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15790 EP400_N	5.8e-215	726.4	E1A-binding protein p400, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008965602.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008958403.1	0.978	Belongs to the histone H2B family.
2	9597.XP_008966933.1	0.966	Belongs to the PI3/PI4-kinase family.
3	9597.XP_008952321.1	0.953	Belongs to the MYST (SAS/MOZ) family.
4	9597.XP_008963004.1	0.915	Bromodomain PHD finger transcription factor
5	9597.XP_003812861.1	0.914	DNA methyltransferase 1 associated protein 1
6	9597.XP_003814340.1	0.911	Proposed core component of the chromatin remodeling Ino80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding.
7	9597.XP_003804484.2	0.905	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
8	9597.XP_003829446.1	0.882	Proposed core component of the chromatin remodeling Ino80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding.
9	9597.XP_003808769.1	0.873	YEATS domain-containing protein 4 isoform X1
10	9597.XP_003817318.1	0.873	Vacuolar protein sorting 72 homolog
11	9597.XP_008952842.1	0.859	Bromodomain-containing protein 8 isoform X1
12	9597.XP_003832013.1	0.842	Belongs to the actin family.
13	9597.XP_003810896.1	0.840	MRG/MORF4L-binding protein
14	9597.XP_008973561.1	0.828	Thyroid hormone receptor interactor 12
15	9597.XP_008966731.1	0.791	MYST/Esa1 associated factor 6
16	9597.XP_008965629.1	0.790	E1A binding protein p300
17	9597.XP_003814844.1	0.788	Enhancer of polycomb homolog 1
18	9597.XP_003807244.1	0.784	Zinc finger HIT domain-containing protein 1
19	9597.XP_003819676.1	0.772	Mortality factor 4 like 2
20	9597.XP_003810762.2	0.766	Mortality factor 4-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.957	regulation of biological process
GO:0050794	0.935	regulation of cellular process
GO:0019222	0.911	regulation of metabolic process
GO:0051171	0.871	regulation of nitrogen compound metabolic process
GO:0044238	0.867	primary metabolic process
GO:0080090	0.866	regulation of primary metabolic process
GO:0071704	0.857	organic substance metabolic process
GO:0006807	0.856	nitrogen compound metabolic process
GO:0019219	0.847	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.840	regulation of macromolecule metabolic process
GO:0009893	0.840	positive regulation of metabolic process
GO:0010604	0.832	positive regulation of macromolecule metabolic process
GO:0048522	0.830	positive regulation of cellular process
GO:0051173	0.823	positive regulation of nitrogen compound metabolic process
GO:0043170	0.822	macromolecule metabolic process
GO:0031325	0.682	positive regulation of cellular metabolic process
GO:0045935	0.672	positive regulation of nucleobase-containing compound metabolic process
GO:0036211	0.529	protein modification process
GO:0016570	0.482	histone modification
GO:0009987	0.419	cellular process
GO:0018205	0.414	peptidyl-lysine modification
GO:0048583	0.400	regulation of response to stimulus
GO:0051052	0.393	regulation of DNA metabolic process
GO:0006473	0.385	protein acetylation
GO:0006475	0.375	internal protein amino acid acetylation
GO:0010468	0.364	regulation of gene expression
GO:0080134	0.346	regulation of response to stress
GO:0051252	0.342	regulation of RNA metabolic process
GO:0043967	0.317	histone H4 acetylation
GO:0009889	0.306	regulation of biosynthetic process
GO:2000781	0.304	positive regulation of double-strand break repair
GO:0010556	0.300	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.582	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]