StarFunc result for job id Q6ZTW0

User Input

>input (290 residues)
MAAVEKRRQAVPPPAGFTDSGRQSVSRAAGAAESEEDFLRQVGVTEMLRAALLKVLEARP
EEPIAFLAHYFENMGLRSPVNGGAGEPPGQLLLQQQRLGRALWHLRLAHHSQRAAFNNNV
SVAYECLSAGGRRKRPGLDGRTYSELLRRICRDGQAPEEVVAPLLRKVQCRDHEAVPLSV
FRAGTLTCFVLLEFVARAGALFQLLEDSAAAVADRRVGQAVLDTLEGALQASDAAAPARF
LEAGSRLGPDSLALALDRAVGGRRPSAPMTREEFLERAAALFIAKVKPVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZTW0	1.000	1.000	1.506E-43	290	1.000	1.000	Q6ZTW0.pdb.gz	TPGS1_HUMAN Tubulin polyglutamylase complex subunit 1 OS=Homo sapiens OX=9606 GN=TPGS1 PE=1 SV=2
2	AFDB:Q99MS8	0.856	0.820	1.425E-35	303	0.862	0.825	Q99MS8.pdb.gz	TPGS1_MOUSE Tubulin polyglutamylase complex subunit 1 OS=Mus musculus OX=10090 GN=Tpgs1 PE=1 SV=1
3	AFDB:D6RDB0	0.125	0.125	2.433E-1	288	0.134	0.135	D6RDB0.pdb.gz	D6RDB0_HUMAN Solute carrier family 41 member (Fragment) OS=Homo sapiens OX=9606 GN=SLC41A3 PE=1 SV=1
4	AFDB:Q9VQI5	0.164	0.132	2.433E-1	425	0.148	0.101	Q9VQI5.pdb.gz	Q9VQI5_DROME Interferon-related developmental regulator 1 OS=Drosophila melanogaster OX=7227 GN=Ifrd1 PE=1 SV=2
5	AFDB:Q1LY17	0.157	0.085	2.687E-1	835	0.148	0.051	Q1LY17.pdb.gz	Q1LY17_DANRE Nucleolar MIF4G domain-containing protein 1 isoform 1 OS=Danio rerio OX=7955 GN=si:ch211-266o5.1 PE=1 SV=2
6	AFDB:Q3UFM5	0.157	0.082	2.687E-1	854	0.166	0.056	Q3UFM5.pdb.gz	NOM1_MOUSE Nucleolar MIF4G domain-containing protein 1 OS=Mus musculus OX=10090 GN=Nom1 PE=1 SV=2
7	AFDB:P95000	0.121	0.096	4.875E-1	417	0.166	0.115	P95000.pdb.gz	P95000_MYCTO Endolytic murein transglycosylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=mltG PE=3 SV=1
8	AFDB:Q9FEE2	0.158	0.109	5.123E-1	480	0.110	0.067	Q9FEE2.pdb.gz	TON2_ARATH Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 OS=Arabidopsis thaliana OX=3702 GN=TON2 PE=1 SV=1
9	AFDB:Q948U0	0.175	0.068	5.384E-1	963	0.152	0.046	Q948U0.pdb.gz	RBOHA_SOLTU Respiratory burst oxidase homolog protein A OS=Solanum tuberosum OX=4113 GN=RBOHA PE=1 SV=1
10	PDB:7zs9M	0.202	0.189	6.076E-1	310	0.100	0.094	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
11	AFDB:F4JS93	0.162	0.141	7.252E-1	347	0.155	0.130	F4JS93.pdb.gz	F4JS93_ARATH Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At4g13150 PE=1 SV=1
12	PDB:1a2xA	0.189	0.308	9.981E-1	158	0.090	0.165	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
13	PDB:7ktsF	0.134	0.120	9.981E-1	351	0.138	0.114	7ktsF.pdb.gz
14	PDB:7rroI4	0.166	0.232	9.981E-1	187	0.086	0.134	7rroI4.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:5oqrA	0.174	0.091	1.102	751	0.166	0.064	5oqrA.pdb.gz
16	PDB:3bq3A	0.112	0.126	1.560	250	0.083	0.096	3bq3A.pdb.gz
17	PDB:2bb5A	0.123	0.103	1.811	409	0.117	0.083	2bb5A.pdb.gz	Structural basis for mammalian vitamin B12 transport by transcobalamin.
18	PDB:2bb6A	0.137	0.106	1.903	414	0.148	0.104	2bb6A.pdb.gz	Structural basis for mammalian vitamin B12 transport by transcobalamin.
19	PDB:3lkuE	0.189	0.189	2.000	291	0.097	0.096	3lkuE.pdb.gz	Structural characterization of the Get4/Get5 complex and its interaction with Get3.
20	PDB:4ariA	0.151	0.071	2.208	821	0.045	0.016	4ariA.pdb.gz	Structural Dynamics of the Aminoacylation and Proofreading Functional Cycle of Bacterial Leucyl-tRNA Synthetase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZTW0	0.0	571	290	1.000	1.000	TPGS1_HUMAN Tubulin polyglutamylase complex subunit 1 OS=Homo sapiens OX=9606 GN=TPGS1 PE=1 SV=2
2	Q99MS8	4.81e-166	464	303	0.862	0.825	TPGS1_MOUSE Tubulin polyglutamylase complex subunit 1 OS=Mus musculus OX=10090 GN=Tpgs1 PE=1 SV=1
3	P00514	0.058	37.0	380	0.059	0.045	KAP0_BOVIN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR1A PE=1 SV=2
4	P10644	0.061	37.0	381	0.059	0.045	KAP0_HUMAN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A PE=1 SV=1
5	P07802	0.062	37.0	380	0.059	0.045	KAP0_PIG cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Sus scrofa OX=9823 GN=PRKAR1A PE=1 SV=2
6	P09456	0.29	35.0	381	0.055	0.042	KAP0_RAT cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1a PE=1 SV=2
7	P16905	0.42	34.3	376	0.038	0.029	KAPR1_DROME cAMP-dependent protein kinase type I regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R1 PE=1 SV=2
8	Q9DBC7	0.45	34.3	381	0.052	0.039	KAP0_MOUSE cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Mus musculus OX=10090 GN=Prkar1a PE=1 SV=3
9	Q384B9	1.7	32.7	424	0.066	0.045	Q384B9_TRYB2 FAM86 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0830 PE=4 SV=1
10	O35613	1.8	32.7	739	0.138	0.054	DAXX_MOUSE Death domain-associated protein 6 OS=Mus musculus OX=10090 GN=Daxx PE=1 SV=1
11	Q57ZG5	2.6	32.0	490	0.062	0.037	Q57ZG5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27E10.510 PE=4 SV=1
12	P31321	2.9	32.0	381	0.097	0.073	KAP1_HUMAN cAMP-dependent protein kinase type I-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1B PE=1 SV=4
13	Q5AH25	2.9	32.0	667	0.097	0.042	EXO70_CANAL Exocyst complex protein EXO70 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EXO70 PE=3 SV=1
14	Q0MSH9	4.9	31.2	661	0.076	0.033	Q0MSH9_DANRE Receptor-interacting protein 1 OS=Danio rerio OX=7955 GN=rip1 PE=2 SV=1
15	Q7X9B9	5.3	31.2	963	0.079	0.024	NLP2_ARATH Protein NLP2 OS=Arabidopsis thaliana OX=3702 GN=NLP2 PE=2 SV=3
16	P12849	5.4	30.8	381	0.079	0.060	KAP1_MOUSE cAMP-dependent protein kinase type I-beta regulatory subunit OS=Mus musculus OX=10090 GN=Prkar1b PE=1 SV=2
17	P81377	5.4	30.8	381	0.079	0.060	KAP1_RAT cAMP-dependent protein kinase type I-beta regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1b PE=2 SV=2
18	A9C3T0	6.9	30.8	397	0.059	0.043	A9C3T0_DANRE Protein kinase, cAMP-dependent, regulatory, type II, alpha A OS=Danio rerio OX=7955 GN=wu:fb55f12 PE=1 SV=1
19	P07276	6.9	30.8	1031	0.059	0.016	RAD2_YEAST DNA repair protein RAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD2 PE=1 SV=2
20	P29676	6.9	30.0	192	0.059	0.089	EPO_RAT Erythropoietin OS=Rattus norvegicus OX=10116 GN=Epo PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05186 Dpy-30	2.7	19.1	Dpy-30 motif
2	PF10025 DUF2267	1.5e+02	14.1	Uncharacterized conserved protein (DUF2267)
3	PF02197 RIIa	1.3	20.1	Regulatory subunit of type II PKA R-subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352265

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000453273	0.988	Leucine-rich repeat-containing protein 49
2	9606.ENSP00000273598	0.972	Nicolin-1
3	9606.ENSP00000266254	0.965	Probable tubulin polyglutamylase TTLL1
4	9606.ENSP00000464780	0.921	Tubulin polyglutamylase complex subunit 2
5	9606.ENSP00000355621	0.783	Tetratricopeptide repeat domain containing
6	9606.ENSP00000304077	0.771	Olfactory receptor 4K15
7	9606.ENSP00000401770	0.750	6.8 kDa mitochondrial proteolipid
8	9606.ENSP00000446524	0.744	Cytochrome c oxidase assembly protein COX14
9	9606.ENSP00000325562	0.724	MICOS complex subunit MIC10
10	9606.ENSP00000438748	0.640	Protein SMG8
11	9606.ENSP00000378812	0.637	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2
12	9606.ENSP00000431800	0.637	Eukaryotic translation initiation factor 3 subunit F
13	9606.ENSP00000358840	0.618	Up-regulated during skeletal muscle growth protein 5
14	9606.ENSP00000252136	0.614	tRNA (uracil-5-)-methyltransferase homolog A
15	9606.ENSP00000298310	0.603	Nuclear export mediator factor NEMF
16	9606.ENSP00000318029	0.600	Outer dense fiber of sperm tails 3 like 2
17	9606.ENSP00000450909	0.580	SRA stem-loop-interacting RNA-binding protein, mitochondrial
18	9606.ENSP00000367878	0.550	UPF0705 protein C11orf49
19	9606.ENSP00000355250	0.534	Protein moonraker
20	9606.ENSP00000355385	0.529	R3H domain containing 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070740	0.999	tubulin-glutamic acid ligase activity
GO:0008017	0.998	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.977	cellular process
GO:0018200	0.961	peptidyl-glutamic acid modification
GO:0070925	0.958	organelle assembly
GO:0000226	0.955	microtubule cytoskeleton organization
GO:0060271	0.936	cilium assembly
GO:0035082	0.903	axoneme assembly
GO:0048856	0.900	anatomical structure development
GO:0044458	0.900	motile cilium assembly
GO:0120316	0.893	sperm flagellum assembly
GO:0023052	0.796	signaling
GO:0007154	0.793	cell communication
GO:0007267	0.771	cell-cell signaling
GO:0007288	0.771	sperm axoneme assembly
GO:0051179	0.656	localization
GO:0099536	0.607	synaptic signaling
GO:0099537	0.559	trans-synaptic signaling
GO:0065007	0.379	biological regulation
GO:0051640	0.371	organelle localization
GO:0007268	0.357	chemical synaptic transmission
GO:0050789	0.354	regulation of biological process
GO:0051648	0.354	vesicle localization
GO:0050794	0.333	regulation of cellular process
GO:0007610	0.310	behavior

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005737	0.989	cytoplasm
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005829	0.975	cytosol
GO:0005856	0.962	cytoskeleton
GO:0005815	0.954	microtubule organizing center
GO:0005813	0.857	centrosome
GO:0043227	0.461	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.3.2.61	0.999	tubulin-glutamate ligase.

[back to server]