StarFunc result for job id Q6ZU35

User Input

>input (1233 residues)
MGTRAFSHDSIFIPDGGAESEQTVQAMSQDNILGKVKTLQQQLGKNIKFGQRSPNAIPMN
KANSGEASLEEDLFLTSPMEIVTQQDIVLSDAENKSSDTPSSLSPLNLPGAGSEMEEKVA
PVKPSRPKRHFSSAGTIESVNLDAIPLAIARLDNSAAKHKLAVKPKKQRVSKKHRRLAQD
PQHEQGGLESRPCLDQNGHPGEDKPTWHEEEPNPLDSEEERRRQEDYWRELEAKCKRQKA
EAAEKRRLEEQRLQALERRLWEENRRQELLEEEGEGQEPPLEAERAPREEQQRSLEAPGW
EDAERREREERERLEAEEERRRLQAQAQAEERRRLEEDARLEERRRQEEEEGRCAEELKR
QEEEEAEGWEELEQQEAEVQGPPEALEETGEGRRGAEEEDLGEEEEEGQAHLEDWRGQLS
ELLNDFEERLEDQERLKPEGQREHSEEPGICEEQNPEAERRREQQGRSGDFQGADRPGPE
EKREEGDTEPLLKQEGPVEAAQPPVERKEAAALEQGRKVEELRWQEVDERQTMPRPYTFQ
VSSGGKQILFPKVNLSPVTPAKDTGLTAAPQEPKAPKASPVQHALPSSLSVPHTAILVTG
AQLCGPAVNLSQIKDTACKSLLGLEEKKHAEAPAGENPPRGPGDARAGSGKAKPRQESPS
SASALAEWASIRSRILKNAESDPRSSERDQLRPGDESTPRGRCDSRGNQRKTPPVNAKFS
IMPAWQKFSDGGTETSKQSTEAESIRKRPMLGPSEETAPQPPPAGVRELGKGPEKSEMHR
EPADTTEGCKFAKDLPSFLVPSLPYPPQKVVAHTEFTTSSDSETANGIAKPDPVMPGGEE
KASPFGIKLRRTNYSLRFNCDQQAEQKKKKRHSSTGDSADAGPPAAGSARGEKEMEGVAL
KHGPSLPQERKQAPSTRRDSAEPSSSRSVPVAHPGPPPASSQTPAPEHDKAANKMPLAQK
PALAPKPTSQTPPASPLSKLSRPYLVELLSRRAGRPDPEPSEPSKEDQESSDRRPPSPPG
PEERKGQKRDEEEEATERKPASPPLPATQQEKPSQTPEAGRKEKPMLQSRHSLDGSKLTE
KVETAQPLWITLALQKQKGFREQQATREERKQAREAKQAEKLSKENVSVSVQPGSSSVSR
AGSLHKSTALPEEKRPETAVSRLERREQLKKANTLPTSVTVEISDSAPPAPLVKEVTKRF
STPDAAPVSTEPAWLALAKRKAKAWSDCPQIIK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZU35	1.000	1.000	0.000	1233	1.000	1.000	Q6ZU35.pdb.gz	CRACD_HUMAN Capping protein-inhibiting regulator of actin dynamics OS=Homo sapiens OX=9606 GN=CRACD PE=1 SV=3
2	AFDB:Q5PR69	0.154	0.157	3.256E-101	1207	0.676	0.691	Q5PR69.pdb.gz	CRACD_MOUSE Capping protein-inhibiting regulator of actin dynamics OS=Mus musculus OX=10090 GN=Cracd PE=1 SV=4
3	AFDB:Q6P5H2	0.044	0.032	1.880E-8	1864	0.181	0.120	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
4	AFDB:Q960V3	0.068	0.074	3.789E-5	1122	0.148	0.162	Q960V3.pdb.gz	MILT_DROME Trafficking kinesin-binding protein milt OS=Drosophila melanogaster OX=7227 GN=milt PE=1 SV=1
5	AFDB:P35658	0.051	0.035	6.096E-5	2090	0.153	0.090	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
6	AFDB:Q5YL88	0.053	0.054	9.164E-5	1205	0.143	0.146	Q5YL88.pdb.gz	Q5YL88_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
7	AFDB:A0A024R9Y2	0.060	0.066	1.578E-4	1105	0.133	0.148	A0A024R9Y2.pdb.gz
8	AFDB:Q54KI4	0.061	0.062	2.216E-4	1196	0.107	0.110	Q54KI4.pdb.gz	EPS15_DICDI Epidermal growth factor receptor substrate 15 homolog OS=Dictyostelium discoideum OX=44689 GN=eps15 PE=1 SV=1
9	AFDB:Q5RHB5	0.069	0.060	3.113E-4	1447	0.174	0.149	Q5RHB5.pdb.gz	IRAG2_DANRE Inositol 1,4,5-triphosphate receptor associated 2 OS=Danio rerio OX=7955 GN=irag2 PE=1 SV=2
10	AFDB:Q6PAC4	0.061	0.059	3.332E-4	1279	0.150	0.145	Q6PAC4.pdb.gz	PCARE_MOUSE Photoreceptor cilium actin regulator OS=Mus musculus OX=10090 GN=Pcare PE=2 SV=1
11	PDB:7w5a2	0.052	0.404	3.283	123	0.022	0.220	7w5a2.pdb.gz	Mechanism of exon ligation by human spliceosome.
12	PDB:7kzmE	0.029	0.063	8.499	474	0.011	0.027	7kzmE.pdb.gz	Structure of a microtubule-bound axonemal dynein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZU35	0.0	2445	1233	1.000	1.000	CRACD_HUMAN Capping protein-inhibiting regulator of actin dynamics OS=Homo sapiens OX=9606 GN=CRACD PE=1 SV=3
2	Q5PR69	2.31e-123	414	1291	0.177	0.169	CRACD_MOUSE Capping protein-inhibiting regulator of actin dynamics OS=Mus musculus OX=10090 GN=Cracd PE=1 SV=4
3	Q8IDX6	2.89e-04	47.8	3130	0.043	0.017	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
4	Q12019	0.010	42.7	4910	0.049	0.012	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
5	C6KSX6	0.047	40.4	1422	0.024	0.021	C6KSX6_PLAF7 Rhoptry protein ROP14 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0613300 PE=3 SV=1
6	Q54P24	0.069	40.0	1215	0.048	0.049	Q54P24_DICDI DH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcC PE=4 SV=1
7	Q9VMA7	0.20	38.5	1430	0.041	0.036	TGO1_DROME Transport and Golgi organization protein 1 OS=Drosophila melanogaster OX=7227 GN=Tango1 PE=1 SV=2
8	P33332	0.27	38.1	1336	0.036	0.033	SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC3 PE=1 SV=1
9	Q38CJ2	0.56	37.0	764	0.036	0.059	Q38CJ2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7860 PE=4 SV=1
10	Q6FIU8	0.74	36.6	4880	0.027	0.007	Q6FIU8_CANGA Midasin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M11616g PE=3 SV=1
11	A0A1C3NSL9	1.1	36.2	1644	0.037	0.028	AJM1_CAEEL Apical junction molecule OS=Caenorhabditis elegans OX=6239 GN=ajm-1 PE=1 SV=1
12	Q95ZY7	1.8	35.4	1573	0.037	0.029	Q95ZY7_CAEEL Apical junction molecule OS=Caenorhabditis elegans OX=6239 GN=ajm-1 PE=1 SV=2
13	H2KYC5	2.4	35.0	1293	0.037	0.036	H2KYC5_CAEEL Apical junction molecule OS=Caenorhabditis elegans OX=6239 GN=ajm-1 PE=1 SV=2
14	P53352	2.7	34.7	877	0.030	0.042	INCE_CHICK Inner centromere protein OS=Gallus gallus OX=9031 GN=INCENP PE=1 SV=1
15	Q20398	3.8	34.3	1084	0.034	0.039	Q20398_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=magu-4 PE=1 SV=2
16	Q9QZQ1	4.9	33.9	1820	0.024	0.016	AFAD_MOUSE Afadin OS=Mus musculus OX=10090 GN=Afdn PE=1 SV=3
17	O35889	6.2	33.5	1829	0.025	0.017	AFAD_RAT Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 SV=1
18	P49454	7.7	33.5	3114	0.042	0.017	CENPF_HUMAN Centromere protein F OS=Homo sapiens OX=9606 GN=CENPF PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15262 DUF4592	4.4e-41	151.7	Domain of unknown function (DUF4592)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000423366

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269391	0.707	E3 ubiquitin ligase RNF157
2	9606.ENSP00000425864	0.697	BLOC-1-related complex subunit 8
3	9606.ENSP00000414624	0.692	Phosphoribosyl pyrophosphate synthase-associated protein 1
4	9606.ENSP00000432456	0.690	Probable G-protein coupled receptor 61
5	9606.ENSP00000374014	0.616	Transmembrane 6 superfamily member 2
6	9606.ENSP00000371689	0.612	Cadherin-12
7	9606.ENSP00000338885	0.583	Phospholipid transfer protein C2CD2L
8	9606.ENSP00000254624	0.567	Protein EFR3 homolog A
9	9606.ENSP00000439182	0.556	Unconventional myosin-Ih
10	9606.ENSP00000416040	0.526	Belongs to the UPF0606 family
11	9606.ENSP00000362047	0.525	XK-related protein 2
12	9606.ENSP00000353210	0.517	ADP-ribosylation factor-like protein 9
13	9606.ENSP00000340434	0.505	Retrotransposon Gag-like protein 6
14	9606.ENSP00000386213	0.504	Myosin-IIIb

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050789	0.975	regulation of biological process
GO:0050794	0.965	regulation of cellular process
GO:0048518	0.949	positive regulation of biological process
GO:0065008	0.910	regulation of biological quality
GO:0016043	0.908	cellular component organization
GO:0048522	0.884	positive regulation of cellular process
GO:1902903	0.777	regulation of supramolecular fiber organization
GO:0032956	0.777	regulation of actin cytoskeleton organization
GO:0090066	0.764	regulation of anatomical structure size
GO:0008064	0.700	regulation of actin polymerization or depolymerization
GO:0043254	0.695	regulation of protein-containing complex assembly
GO:0043244	0.685	regulation of protein-containing complex disassembly
GO:0032271	0.685	regulation of protein polymerization
GO:1901879	0.684	regulation of protein depolymerization
GO:0030833	0.648	regulation of actin filament polymerization
GO:0051130	0.637	positive regulation of cellular component organization
GO:0051495	0.622	positive regulation of cytoskeleton organization
GO:0043243	0.621	positive regulation of protein-containing complex disassembly
GO:0032273	0.621	positive regulation of protein polymerization
GO:0030834	0.592	regulation of actin filament depolymerization
GO:1902905	0.588	positive regulation of supramolecular fiber organization
GO:0032501	0.332	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005856	0.986	cytoskeleton
GO:0071944	0.954	cell periphery
GO:0005737	0.938	cytoplasm
GO:0016020	0.907	membrane
GO:0015629	0.834	actin cytoskeleton
GO:0005886	0.800	plasma membrane
GO:0043227	0.769	membrane-bounded organelle
GO:0099081	0.438	supramolecular polymer
GO:0099512	0.422	supramolecular fiber
GO:0099513	0.412	polymeric cytoskeletal fiber
GO:0005884	0.386	actin filament
GO:0005829	0.377	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]