StarFunc result for job id Q6ZU64

User Input

>input (1925 residues)
MFTLTGCRLVEKTQKVENPSVSFASSFPLIPLLLRGKSVQKKQAESKSQIKLHTQSAPFG
LCPKDMMLTQAPSSVVRSRNSRNHTVNSGGSCLSASTVAIPAINDSSAAMSACSTISAQP
ASSMDTQMHSPKKQERVNKRVIWGIEVAEELHWKGWELGKETTRNLVLKNRSLKLQKMKY
RPPKTKFFFTVIPQPIFLSPGITLTLPIVFRPLEAKEYMDQLWFEKAEGMFCVGLRATLP
CHRLICRPPSLQLPMCAVGDTTEAFFCLDNVGDLPTFFTWEFSSPFQMLPATGLLEPGQA
SQIKVTFQPLTAVIYEVQATCWYGAGSRQRSSIQLQAVAKCAQLLVSIKHKCPEDQDAEG
FQKLLYFGSVAVGCTSERQIRLHNPSAVNAPFRIEISPDELAEDQAFSCPTAHGIVLPGE
KKCVSVFFHPKTLDTRTVDYCSIMPSGCASKTLLKVVGFCRGPAVSLQHYCVNFSWVNLG
ERSEQPLWIENQSDCTAHFQFAIDCLESVFTIRPAFGTLVGKARMTLHCAFQPTHPIICF
RRVACLIHHQDPLFLDLMGTCHSDSTKPAILKPQHLTWYRTHLARGLTLYPPDILDAMLK
EKKLAQDQNGALMIPIQDLEDMPAPQYPYIPPMTEFFFDGTSDITIFPPPISVEPVEVDF
GACPGPEAPNPVPLCLMNHTKGKIMVVWTRRSDCPFWVTPESCDVPPLKSMAMRLHFQPP
HPNCLYTVELEAFAIYKVLQSYSNIEEDCTMCPSWCLTVRARGHSYFAGFEHHIPQYSLD
VPKLFPAVSSGEPTYRSLLLVNKDCKLLTFSLAPQRGSDVILRPTSGLVAPGAHQIILIC
TYPEGSSWKQHTFYLQCNASPQYLKEVSMYSREEPLQLKLDTHKSLYFKPTWVGCSSTSP
FTFRNPSRLPLQFEWRVSEQHRKLLAVQPSRGLIQPNERLTLTWTFSPLEETKYLFQVGM
WVWEAGLSPNANPAATTHYMLRLVGVGLTSSLSAKEKELAFGNVLVNSKQSRFLVLLNDG
NCTLYYRLYLEQGSPEAVDNHPLALQLDRTEGSMPPRSQDTICLTACPKQRSQYSWTITY
SLLSHRDNKAGEKQELCCVSLVAVYPLLSILDVSSMGSAEGITRKHLWRLFSLDLLNSYL
ERDPTPCELTYKVPTRHSMSQIPPVLTPLRLDFNFGAAPFKAPPSVVFLALKNSGVVSLD
WAFLLPSDQRIDVELWAEQAELNSTELHQMRVQDNCLFSISPKAGSLSPGQEQMVELKYS
HLFIGTDHLPVLFKVSHGREILLNFIGVTVKPEQKYVHFTSTTHQFIPIPIGDTLPPRQI
YELYNGGSVPVTYEVQTDVLSQVQEKNFDHPIFCCLNPKGEIQPGSTARVLWIFSPIEAK
TYTVDVPIHILGWNSALIHFQGVGYNPHMMGDTAPFHNISSWDNSSIHSRLVVPGQNVFL
SQSHISLGNIPVQSKCSRLLFLNNISKNEEIAFSWQPSPLDFGEVSVSPMIGVVAPEETV
PFVVTLRASVHASFYSADLVCKLYSQQLMRQYHKELQEWKDEKVRQEVEFTITDMKVKKR
TCCTACEPARKYKTLPPIKNQQSVSRPASWKLQTPKEEVSWPCPQPPSPGMLCLGLTARA
HATDYFLANFFSEFPCHFLHRELPKRKAPREESETSEEKSPNKWGPVSKQKKQLLVDILT
TIIRGLLEDKNFHEAVDQSLVEQVPYFRQFWNEQSTKFMDQKNSLYLMPILPVPSSSWED
GKGKQPKEDRPEHYPGLGKKEEGEEEKGEEEEEELEEEEEEEEETEEEELGKEEIEEKEE
ERDEKEEKVSWAGIGPTPQPESQESMQWQWQQQLNVMVKEEQEQDEKEAIRRLPAFANLQ
EALLENMIQNILVEASRGEVVLTSRPRVIALPPFCVPRSLTPDTLLPTQQAEVLHPVVPL
PTDLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8JFU2	0.415	0.381	0.000	2118	0.213	0.194	A8JFU2.pdb.gz	CFA65_CHLRE Cilia- and flagella-associated protein 65 (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP65 PE=1 SV=1
2	AFDB:Q38AM8	0.415	0.443	0.000	1794	0.184	0.198	Q38AM8.pdb.gz	Q38AM8_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3330 PE=4 SV=1
3	AFDB:Q3V0B4	0.605	0.628	0.000	1847	0.689	0.718	Q3V0B4.pdb.gz	CFA65_MOUSE Cilia- and flagella-associated protein 65 OS=Mus musculus OX=10090 GN=Cfap65 PE=1 SV=1
4	AFDB:Q6ZU64	1.000	1.000	0.000	1925	1.000	1.000	Q6ZU64.pdb.gz	CFA65_HUMAN Cilia- and flagella-associated protein 65 OS=Homo sapiens OX=9606 GN=CFAP65 PE=1 SV=2
5	AFDB:Q388P3	0.152	0.249	9.527E-54	1046	0.085	0.157	Q388P3.pdb.gz	Q388P3_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0270 PE=4 SV=1
6	PDB:7sqcO0	0.107	0.164	5.131E-50	1140	0.084	0.142	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
7	AFDB:Q18264	0.082	0.086	3.829E-39	1831	0.113	0.119	Q18264.pdb.gz	Q18264_CAEEL TMEM131_like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tmem-131 PE=1 SV=4
8	AFDB:Q6WRI0	0.088	0.070	1.030E-22	2623	0.072	0.053	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
9	AFDB:P43146	0.084	0.103	2.625E-20	1447	0.102	0.135	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
10	AFDB:P97603	0.083	0.106	2.888E-20	1377	0.097	0.135	P97603.pdb.gz	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
11	AFDB:Q0E9F2	0.087	0.101	9.089E-20	1542	0.089	0.111	Q0E9F2.pdb.gz	Q0E9F2_DROME Sticks and stones, isoform B OS=Drosophila melanogaster OX=7227 GN=sns PE=1 SV=1
12	PDB:7vonA	0.070	0.091	2.194E-17	1399	0.049	0.067	7vonA.pdb.gz
13	PDB:7q1yA	0.071	0.091	6.906E-17	1374	0.050	0.071	7q1yA.pdb.gz
14	PDB:7q5zA	0.068	0.089	3.675E-16	1344	0.045	0.065	7q5zA.pdb.gz
15	PDB:5a42A	0.061	0.068	3.855E-16	1597	0.056	0.067	5a42A.pdb.gz
16	PDB:4lnvA	0.065	0.088	8.278E-16	1276	0.052	0.078	4lnvA.pdb.gz
17	PDB:4bxsV	0.054	0.069	1.272E-15	1262	0.074	0.113	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
18	PDB:6h03A	0.071	0.091	3.308E-15	1223	0.051	0.080	6h03A.pdb.gz
19	PDB:7sqcO1	0.120	0.305	9.460E-15	673	0.026	0.074	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:1e07A	0.090	0.184	1.846E-14	642	0.038	0.114	1e07A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3V0B4	0.0	2669	1847	0.689	0.718	CFA65_MOUSE Cilia- and flagella-associated protein 65 OS=Mus musculus OX=10090 GN=Cfap65 PE=1 SV=1
2	Q6ZU64	0.0	3986	1925	1.000	1.000	CFA65_HUMAN Cilia- and flagella-associated protein 65 OS=Homo sapiens OX=9606 GN=CFAP65 PE=1 SV=2
3	A8JFU2	6.91e-103	370	2118	0.177	0.161	CFA65_CHLRE Cilia- and flagella-associated protein 65 (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP65 PE=1 SV=1
4	Q38AM8	2.58e-88	323	1794	0.185	0.199	Q38AM8_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3330 PE=4 SV=1
5	Q4G0P3	1.53e-08	62.8	5121	0.028	0.011	HYDIN_HUMAN Hydrocephalus-inducing protein homolog OS=Homo sapiens OX=9606 GN=HYDIN PE=1 SV=3
6	Q80W93	4.87e-08	61.2	5154	0.028	0.010	HYDIN_MOUSE Hydrocephalus-inducing protein OS=Mus musculus OX=10090 GN=Hydin PE=1 SV=2
7	Q583L9	1.70e-04	49.3	4521	0.033	0.014	Q583L9_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.940 PE=4 SV=1
8	Q8IDY5	0.007	43.5	459	0.009	0.039	Q8IDY5_PLAF7 MSP7-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1334300 PE=4 SV=1
9	Q9WV62	0.009	42.4	253	0.018	0.138	Q9WV62_RAT Kinesin-like protein KIF3A (Fragment) OS=Rattus norvegicus OX=10116 GN=Kif3a PE=2 SV=1
10	Q8IHN4	0.037	41.6	6093	0.016	0.005	Q8IHN4_PLAF7 Antigen 332, DBL-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1149000 PE=4 SV=2
11	Q23357	0.62	37.4	668	0.016	0.045	CD112_CAEEL Cyclin-dependent kinase 11.2 OS=Caenorhabditis elegans OX=6239 GN=cdk-11.2 PE=1 SV=2
12	Q54M56	0.87	37.0	485	0.012	0.049	Q54M56_DICDI rRNA adenine N(6)-methyltransferase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286199 PE=3 SV=1
13	Q8I3S3	1.3	36.6	1894	0.015	0.015	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1
14	O14319	1.4	36.2	569	0.013	0.044	CUE5_SCHPO CUE domain-containing protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16E9.02c PE=4 SV=1
15	Q6FIU8	1.5	36.6	4880	0.016	0.006	Q6FIU8_CANGA Midasin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M11616g PE=3 SV=1
16	Q8IFW6	2.5	35.4	612	0.009	0.029	Q8IFW6_DROME DEK protein OS=Drosophila melanogaster OX=7227 GN=Dek PE=1 SV=1
17	F1SHI5	2.8	35.4	1557	0.022	0.027	F1SHI5_PIG Bromodomain adjacent to zinc finger domain 1A OS=Sus scrofa OX=9823 GN=BAZ1A PE=4 SV=2
18	P91156	2.9	35.0	580	0.013	0.043	P91156_CAEEL SAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acin-1 PE=1 SV=2
19	A2VD23	7.1	33.9	613	0.006	0.020	STM_DANRE Protein starmaker OS=Danio rerio OX=7955 GN=stm PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15780 ASH	6.3e-36	133.9	Abnormal spindle-like microcephaly-assoc'd, ASPM-SPD-2-Hydin
2	PF00635 Motile_Sperm	1.9e-11	55.1	MSP (Major sperm protein) domain
3	PF14874 PapD-like	0.15	23.6	Flagellar-associated PapD-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340776

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349568	0.806	Cilia and flagella associated protein 43
2	9606.ENSP00000420854	0.769	EF-hand calcium-binding domain-containing protein 12
3	9606.ENSP00000297866	0.755	Cilia- and flagella-associated protein 47
4	9606.ENSP00000377522	0.751	Motile sperm domain containing 3
5	9606.ENSP00000373948	0.714	Cilia- and flagella-associated protein 69
6	9606.ENSP00000295728	0.713	Beta-crystallin A2
7	9606.ENSP00000367926	0.683	Cilia- and flagella-associated protein 47
8	9606.ENSP00000367929	0.683	Cilia- and flagella-associated protein 47
9	9606.ENSP00000288912	0.646	Cilia- and flagella-associated protein 251
10	9606.ENSP00000295759	0.644	Beta-galactosidase-1-like protein
11	9606.ENSP00000415027	0.640	Uncharacterized protein C16orf96
12	9606.ENSP00000357079	0.633	Cilia and flagella associated protein 45
13	9606.ENSP00000359819	0.624	Motile sperm domain-containing protein 1
14	9606.ENSP00000376732	0.606	Mitochondrial ribosomal protein S33
15	9606.ENSP00000483356	0.596	RIB43A domain with coiled-coils 2
16	9606.ENSP00000398798	0.590	Zinc finger protein 142
17	9606.ENSP00000386272	0.580	Putative sodium-coupled neutral amino acid transporter 11
18	9606.ENSP00000362392	0.548	Cilia- and flagella-associated protein 157
19	9606.ENSP00000267615	0.545	Inositol-tetrakisphosphate 1-kinase
20	9606.ENSP00000355900	0.539	Spermatogenesis-associated protein 17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.996	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0007018	0.976	microtubule-based movement
GO:0030317	0.970	flagellated sperm motility
GO:0048856	0.965	anatomical structure development
GO:0000226	0.952	microtubule cytoskeleton organization
GO:0007286	0.950	spermatid development
GO:0120316	0.927	sperm flagellum assembly
GO:0035082	0.926	axoneme assembly
GO:0007288	0.887	sperm axoneme assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0036126	0.999	sperm flagellum
GO:0012505	0.994	endomembrane system
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0031982	0.723	vesicle
GO:0097708	0.705	intracellular vesicle
GO:0031410	0.704	cytoplasmic vesicle
GO:0043232	0.528	intracellular non-membrane-bounded organelle
GO:0097225	0.357	sperm midpiece
GO:0099503	0.339	secretory vesicle
GO:0030141	0.325	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]