StarFunc result for job id Q6ZU65

User Input

>input (1347 residues)
MAEPRRVAFISLSPVRRREAEYPGPEREPEYPREPPRLEPQPYREPARAEPPAPREPAPR
SDAQPPSREKPLPQREVSRAEPPMSLQREPPRPEPPPPFPPLPLQPPPPRESASRAEQPP
RPPRETVRLELVLKDPTDESCVEFSYPELLLCGEQRKKLIHTEDPFNDEHQERQEVEMLA
KKFEMKYGGKPRKHRKDRLQDLIDIGFGYDETDPFIDNSEAYDELVPASLTTKYGGFYIN
TGTLQFRQASDTEEDDITDNQKHKPPKVPKIKEDDIEMKKRKRKEEGEKEKKPRKKVPKQ
LGVVALNSHKSEKKKKRYKDSLSLAAMIRKFQKEKDALKKESNPKVPVTLSTPSLNKPPC
AAAALGNDVPDLNLSSGDPDLPIFVSTNEHELFQEAENALEMLDDFDFDRLLDAASDGSP
LSESGGENGTTTQPTYTSQVMPKVVPTLPEGLPVLLEKRIEDLRVAAKLFDEEGRKKFFT
QDMNNILLDIELQLQELGPVIRSGVYSHLEAFVPCNKETLVKRLKKLHLNVQDDRLREPL
QKLKLAVSNVMPEQLFKYQEDCQARSQAKCAKLQTDEEREKNGSEEDDDEKPGKRVIGPR
KKFHWDDTIRTLLCNLVEIKLGCYELEPNKSQSAEDYLKSFMETEVKPLWPKGWMQARML
FKESRSVHNHLTSAPAKKKVIPAPKPKVKEVMVKTLPLHSFPTMLKECSPKKDQKTPTSL
VASVSGPPTSSSTAAIAAASSSSAPAQETICLDDSLDEDLSFHSPSLDLVSEALAVINNG
NKGPPVGSRISMPTTKPRPGLREEKLASIMSKLPLATPKKLDSTQTTHSSSLIAGHTGPV
PKKPQDLAHTGISSGLIAGSSIQNPKVSLEPLPARLLQQGLQRSSQIHTSSSSQTHVSSS
SQAQIAASSHALGTSEAQDASSLTQVTKVHQHSAVQQNYVSPLQATISKSQTNPVVKLSN
NPQLSCSSSLIKTSDKPLMYRLPLSTPSPGNGSQGSHPLVSRTVPSTTTSSNYLAKAMVS
QISTQGFKSPFSMAASPKLAASPKPATSPKPLPSPKPSASPKPSLSAKPSVSTKLISKSN
PTPKPTVSPSSSSPNALVAQGSHSSTNSPVHKQPSGMNISRQSPTLNLLPSSRTSGLPPT
KNLQAPSKLTNSSSTGTVGKNSLSGIAMNVPASRGSNLNSSGANRTSLSGGTGSGTQGAT
KPLSTPHRPSTASGSSVVTASVQSTAGASLLANASPLTLMTSPLSVTNQNVTPFGMLGGL
VPVTMPFQFPLEIFGFGTDTAGVTTTSGSTSAAFHHSLTQNLLKGLQPGGAQHAATLSHS
PLPAHLQQAFHDGGQSKGDTKLPRKSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZU65	0.999	0.999	0.000	1347	1.000	1.000	Q6ZU65.pdb.gz	UBN2_HUMAN Ubinuclein-2 OS=Homo sapiens OX=9606 GN=UBN2 PE=1 SV=2
2	AFDB:Q4G0F8	0.270	0.311	5.670E-56	1135	0.329	0.390	Q4G0F8.pdb.gz	UBN1_MOUSE Ubinuclein-1 OS=Mus musculus OX=10090 GN=Ubn1 PE=2 SV=1
3	AFDB:Q9NPG3	0.248	0.289	9.632E-55	1134	0.331	0.393	Q9NPG3.pdb.gz	UBN1_HUMAN Ubinuclein-1 OS=Homo sapiens OX=9606 GN=UBN1 PE=1 SV=2
4	AFDB:P21263	0.034	0.027	5.066E-8	1893	0.173	0.123	P21263.pdb.gz	NEST_RAT Nestin OS=Rattus norvegicus OX=10116 GN=Nes PE=1 SV=2
5	AFDB:Q6P5H2	0.051	0.039	1.719E-7	1864	0.169	0.122	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
6	AFDB:H6D7E6	0.051	0.046	6.891E-7	1554	0.162	0.140	H6D7E6.pdb.gz	TALD3_DANRE Protein TALPID3 OS=Danio rerio OX=7955 GN=talpid3 PE=2 SV=1
7	AFDB:P35658	0.033	0.027	6.012E-6	2090	0.148	0.095	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
8	AFDB:Q9R0I7	0.057	0.056	6.355E-6	1386	0.134	0.130	Q9R0I7.pdb.gz	YLPM1_MOUSE YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2
9	AFDB:Q6ZPZ3	0.038	0.038	7.507E-6	1304	0.143	0.148	Q6ZPZ3.pdb.gz	ZC3H4_MOUSE Zinc finger CCCH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zc3h4 PE=1 SV=2
10	AFDB:Q8INR6	0.050	0.041	9.375E-6	1848	0.145	0.106	Q8INR6.pdb.gz	DOT1L_DROME Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Drosophila melanogaster OX=7227 GN=gpp PE=1 SV=2
11	PDB:7ungA0	0.048	0.168	4.476E-1	220	0.023	0.141	7ungA0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
12	PDB:7kzqE	0.048	0.113	4.732E-1	419	0.022	0.072	7kzqE.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
13	PDB:7r5j00	0.041	0.058	5.288E-1	756	0.022	0.040	7r5j00.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
14	PDB:6bzoF	0.039	0.100	5.909E-1	326	0.034	0.141	6bzoF.pdb.gz	Fidaxomicin jamsMycobacterium tuberculosisRNA polymerase motions needed for initiation via RbpA contacts.
15	PDB:6fyxo	0.052	0.103	7.379E-1	529	0.019	0.047	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
16	PDB:6iczJ	0.037	0.070	7.379E-1	571	0.033	0.079	6iczJ.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
17	PDB:7ungi	0.024	0.098	7.379E-1	250	0.030	0.160	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
18	PDB:7mqaLM	0.059	0.043	7.800E-1	2041	0.024	0.016	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7ni5A	0.061	0.034	7.800E-1	2791	0.021	0.010	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.
20	PDB:7r5jK0	0.036	0.042	9.740E-1	1086	0.032	0.040	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZU65	0.0	2721	1347	1.000	1.000	UBN2_HUMAN Ubinuclein-2 OS=Homo sapiens OX=9606 GN=UBN2 PE=1 SV=2
2	Q4G0F8	1.42e-157	506	1135	0.241	0.286	UBN1_MOUSE Ubinuclein-1 OS=Mus musculus OX=10090 GN=Ubn1 PE=2 SV=1
3	Q9NPG3	2.53e-157	505	1134	0.246	0.292	UBN1_HUMAN Ubinuclein-1 OS=Homo sapiens OX=9606 GN=UBN1 PE=1 SV=2
4	P25992	4.49e-16	86.7	1002	0.030	0.041	YEMA_DROME yemanuclein OS=Drosophila melanogaster OX=7227 GN=yem PE=1 SV=1
5	K7EJT1	4.15e-11	68.2	312	0.049	0.212	K7EJT1_HUMAN Ubinuclein 1 (Fragment) OS=Homo sapiens OX=9606 GN=UBN1 PE=1 SV=8
6	A0P8X0	1.9	35.4	1290	0.030	0.032	AAMY_NIACI Alpha-amylase OS=Niallia circulans OX=1397 GN=igtZ PE=1 SV=1
7	F1M775	2.4	35.0	1265	0.011	0.012	DIAP1_RAT Protein diaphanous homolog 1 OS=Rattus norvegicus OX=10116 GN=Diaph1 PE=1 SV=3
8	Q9L7Q2	4.4	34.3	1906	0.022	0.015	ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=zmpB PE=3 SV=2
9	O08808	4.6	34.3	1255	0.014	0.015	DIAP1_MOUSE Protein diaphanous homolog 1 OS=Mus musculus OX=10090 GN=Diaph1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08729 HUN	2.6e-15	67.5	HPC2 and ubinuclein domain
2	PF14075 UBN_AB	8.2e-74	259.4	Ubinuclein conserved middle domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000418648

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229595	0.854	Histone chaperone ASF1A
2	9606.ENSP00000282516	0.711	Nipped-B-like protein
3	9606.ENSP00000263208	0.653	Protein HIRA
4	9606.ENSP00000478754	0.653	Probable ATP-dependent RNA helicase DDX6
5	9606.ENSP00000418693	0.631	RWD domain containing 2B
6	9606.ENSP00000381364	0.625	Calcineurin-binding protein cabin-1
7	9606.ENSP00000339356	0.606	Killer cell lectin like receptor G2
8	9606.ENSP00000263382	0.584	Histone chaperone ASF1B
9	9606.ENSP00000334501	0.584	DMRT like family C1B
10	9606.ENSP00000471224	0.581	Doublesex- and mab-3-related transcription factor C1
11	9606.ENSP00000439170	0.580	Tubulin-specific chaperone E
12	9606.ENSP00000262126	0.576	Ankyrin repeat domain-containing protein 12
13	9606.ENSP00000345029	0.564	Protein FAM47A
14	9606.ENSP00000334808	0.554	Ubiquitin carboxyl-terminal hydrolase 16
15	9606.ENSP00000356579	0.539	Centrosome-associated protein 350
16	9606.ENSP00000262043	0.528	PHD finger protein 3
17	9606.ENSP00000300961	0.528	Junctional sarcoplasmic reticulum protein 1
18	9606.ENSP00000382513	0.526	Zinc finger protein 594
19	9606.ENSP00000304071	0.520	Uncharacterized protein C7orf33
20	9606.ENSP00000312299	0.518	Protein FRG2-like-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0043933	0.967	protein-containing complex organization
GO:0071824	0.943	protein-DNA complex subunit organization
GO:0006338	0.928	chromatin remodeling
GO:0065007	0.740	biological regulation
GO:0050789	0.693	regulation of biological process
GO:0050794	0.642	regulation of cellular process
GO:0065003	0.584	protein-containing complex assembly
GO:0065004	0.514	protein-DNA complex assembly
GO:0034728	0.438	nucleosome organization
GO:0019222	0.430	regulation of metabolic process
GO:0060255	0.419	regulation of macromolecule metabolic process
GO:0006334	0.408	nucleosome assembly
GO:0051171	0.369	regulation of nitrogen compound metabolic process
GO:0031323	0.369	regulation of cellular metabolic process
GO:0080090	0.364	regulation of primary metabolic process
GO:0019219	0.338	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.331	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005576	0.995	extracellular region
GO:0005615	0.990	extracellular space
GO:0043232	0.893	intracellular non-membrane-bounded organelle
GO:0005737	0.774	cytoplasm
GO:0005829	0.601	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]