StarFunc result for job id Q6ZU69

User Input

>input (1335 residues)
MLSPTFVLWEVGYPLYIYGSIFIVIVIIWQVKRSHHELSSEPKRSCCRCHQKVRQRARDA
ASTARRRSREEAEKPQKLLSIIKSQGWLPLERSVRRILCADPCCQICNSVALEIQQLLVG
ENNQISLTLSGPLQGSSCLEMLSTSSMSLDQSLEFHSWHTRELSLSSVTPTLSQLTDQKS
LTQSAAQSTYADGIQDYWADHLQLGQEFQVPDVLRGPNTIASSRIEKPRAPLNQEEMTQS
NPSLVQGNQGQHHLNSQVSLLSLNPETLNRMHPMALHMVLPAHLPFLSPEVLRLLEVHVK
KWMHFQRWGLPRRVEESLRQLMPNPPLYYQPGNDQPVSFNLKNTPQVSLHRFETISLQTW
CSCVAGQPIQTFWVSEWSTMNPEQRHHCQQTPNPMALALPSPALKALSGPHPQSGGQDND
SGSDLQQKYSQLFCGLPSLHSESLVATFMGSQGLPKIENVPKPPLKDPFLFNELSFPQLL
PKTSPQSAPPSSPLSPNWMSPSDHQRAQINVPFLTLAEYEALEWHLLQRQLQLQWGWPAA
LQRSQHTQCLMQHEPCGKAQSPETTTASQTGKSISVLTRELLFFPEHARKLLEFHIQKQL
IRHRWGLPQKIQQSIQLLLTSTDQQTVSSSSTALANVSIPQPVALEANGACDVLSPIAAP
VSIPRPHLLTQVKAILQSHIDSKCGQIHQGKIPACVHRSWDCRISGVLAVAPFPCIPESQ
FLELQTASDPDLHHKVMPWMPTALDQQQQALPGTVTEHPKLLRVLSVEAIEKLETTLRHK
HLAFLSGLPALYYVALPRALAPAVTSQSVITEMEPSPVEIPAEPLIQMVSFEEQCISLGP
CPQGNNESCTDVAKEFQPAVPVKGTMETLPLESQTHPTSPHSLQTHILTKLNFHLRKKVL
EIQWGIPIRARKSREQTVAAPENISTQKSLESLNHQGETLLQELPIPPDTLPAPNPEGVH
LKEQLANDLKAVQQNQKQSNSKAVPQGSAHSVSKISQPSGDMTEAHMPCVQVEANVNKPS
LEEPCGPEPQSPSKSKDPAHVPMLAGNREDPEETKAARDHREGDAGFGRSSTREERRPAE
DQRPAGMLPNKTPRGSWRWSRSFHLADPCQHSPQHHPQLKLPQLPPRVPGEKESEKDLQD
SQTKLTVILEPATIPENAQTVLPQASQGQPFLSQPTQAKPLQGQTLQGQVLHGLVMPVHA
QKKPSLTESSFRNKIKCFLQHINPKTKGKGHEDSMFSAAAKVAKTRKENVAKSLAPAKSP
VGRSKTEKPTGCSKAQSRPAQKLVGPAFLDGPQSLDDKLRLHSRQPGSASALGYPRHCPR
HCPREACANKPGHPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZU69	1.000	1.000	0.000	1335	1.000	1.000	Q6ZU69.pdb.gz	S31F1_HUMAN Protein SPATA31F1 OS=Homo sapiens OX=9606 GN=SPATA31F1 PE=2 SV=4
2	AFDB:Q6P5H2	0.044	0.035	1.333E-7	1864	0.173	0.124	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
3	AFDB:A8DYK5	0.045	0.046	1.198E-4	1306	0.134	0.137	A8DYK5.pdb.gz	A8DYK5_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Isha PE=1 SV=1
4	AFDB:P48681	0.048	0.041	3.721E-4	1621	0.135	0.111	P48681.pdb.gz	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
5	AFDB:Q9VHP9	0.040	0.038	6.985E-4	1411	0.124	0.117	Q9VHP9.pdb.gz	Q9VHP9_DROME Centromeric protein-C, isoform A OS=Drosophila melanogaster OX=7227 GN=Cenp-C PE=1 SV=4
6	AFDB:Q24079	0.054	0.058	1.019E-3	1221	0.117	0.128	Q24079.pdb.gz	Q24079_DROME E93 OS=Drosophila melanogaster OX=7227 GN=Eip93F PE=2 SV=1
7	AFDB:Q4G0F8	0.045	0.051	2.791E-3	1135	0.123	0.144	Q4G0F8.pdb.gz	UBN1_MOUSE Ubinuclein-1 OS=Mus musculus OX=10090 GN=Ubn1 PE=2 SV=1
8	AFDB:Q4AB30	0.041	0.049	2.973E-3	1044	0.109	0.140	Q4AB30.pdb.gz	Q4AB30_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=gukh PE=1 SV=1
9	AFDB:Q499E5	0.033	0.042	3.591E-3	926	0.103	0.148	Q499E5.pdb.gz	STOX2_MOUSE Storkhead-box protein 2 OS=Mus musculus OX=10090 GN=Stox2 PE=2 SV=2
10	AFDB:P23226	0.042	0.046	7.645E-3	1185	0.127	0.143	P23226.pdb.gz	MA205_DROME 205 kDa microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=Map205 PE=1 SV=2
11	PDB:6o9l3	0.046	0.167	6.258	309	0.017	0.074	6o9l3.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
12	PDB:7rroB0	0.050	0.195	8.050	189	0.017	0.122	7rroB0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
13	PDB:2rvqC	0.022	0.116	8.573	133	0.014	0.143	2rvqC.pdb.gz
14	PDB:4v60A	0.050	0.075	9.724	812	0.016	0.027	4v60A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZU69	0.0	2716	1335	1.000	1.000	S31F1_HUMAN Protein SPATA31F1 OS=Homo sapiens OX=9606 GN=SPATA31F1 PE=2 SV=4
2	Q6GQS8	1.48e-135	429	569	0.204	0.478	Q6GQS8_MOUSE SPATA31 domain-containing protein OS=Mus musculus OX=10090 GN=Gm21093 PE=2 SV=1
3	Q8IWB4	8.42e-07	56.2	1347	0.052	0.052	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
4	B6VQA5	1.59e-05	52.0	1048	0.071	0.091	SPT31_RAT Spermatogenesis-associated protein 31 OS=Rattus norvegicus OX=10116 GN=Spata31 PE=1 SV=1
5	Q9LQ32	1.4	35.0	297	0.029	0.131	GXM3_ARATH Glucuronoxylan 4-O-methyltransferase 3 OS=Arabidopsis thaliana OX=3702 GN=GXM3 PE=1 SV=1
6	Q9VD58	2.8	34.3	370	0.022	0.078	Q9VD58_DROME GH26270p OS=Drosophila melanogaster OX=7227 GN=Idh3b PE=1 SV=1
7	Q19262	4.7	33.9	796	0.013	0.021	EXOC3_CAEEL Exocyst complex component 3 OS=Caenorhabditis elegans OX=6239 GN=sec-6 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09076 Crystall_2	5.2e+02	11.9	Beta/Gamma crystallin
2	PF15371 DUF4599	7.1e-26	101.7	Domain of unknown function (DUF4599)
3	PF14650 FAM75	6.1e-30	116.7	FAM75 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417711

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344729	0.608	Protein FAM166A
2	9606.ENSP00000392452	0.606	Protein FAM219A
3	9606.ENSP00000335017	0.596	Proline-rich protein 30
4	9606.ENSP00000321426	0.595	Olfactory receptor 52E4
5	9606.ENSP00000326652	0.566	Protein FAM71F1
6	9606.ENSP00000455854	0.563	Testis-expressed protein 38
7	9606.ENSP00000368189	0.561	AT-rich interactive domain-containing protein 3C
8	9606.ENSP00000317327	0.542	Ubiquitin-associated and SH3 domain-containing protein A
9	9606.ENSP00000413196	0.521	Protein FAM160A1
10	9606.ENSP00000483897	0.519	Lysozyme-like protein 6
11	9606.ENSP00000297623	0.517	Spermatid-specific manchette-related protein 1
12	9606.ENSP00000288065	0.510	Armadillo repeat containing 12
13	9606.ENSP00000297613	0.505	Ribonuclease P protein subunit p25-like protein
14	9606.ENSP00000297625	0.502	Myogenesis-regulating glycosidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.947	developmental process
GO:0032501	0.947	multicellular organismal process
GO:0021549	0.927	cerebellum development
GO:0030900	0.893	forebrain development
GO:0021537	0.874	telencephalon development
GO:0009987	0.599	cellular process
GO:0021695	0.436	cerebellar cortex development
GO:0021772	0.432	olfactory bulb development
GO:0021680	0.432	cerebellar Purkinje cell layer development
GO:0065007	0.356	biological regulation
GO:0050794	0.335	regulation of cellular process
GO:0021543	0.335	pallium development
GO:0021766	0.312	hippocampus development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.639	cytoplasm
GO:0012505	0.300	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]