StarFunc result for job id Q6ZUB1

User Input

>input (1445 residues)
MGNLVIPLGKGRAGRVESGQRIPPPAPRPSVECTGDDIALQMEKMLFPLKSPSATWLSPS
STPWMMDFILTSVCGLVLLFLLLLYVHSDPPSPPPGRKRSSREPQRERSGRSRSRKISAL
KACRILLRELEETRDLNYLLESHLRKLAGEGSSHLPLGGDPLGDVCKPVPAKAHQPHGKC
MQDPSPASLSPPAPPAPLASTLSPGPMTFSEPFGPHSTLSASGPPEPLLPLKCPATQPHV
VFPPSPQPHGPLASSPPPPDSSLAGLQCGSTTCPVPQSSPLHNQVLPPPTRVISGLGCSS
DPIWDLYCWREAATTWGLSTYSHGKSQPRHLPDHTSEASFWGDPTPKHMEVGGCTFIHPD
VQKLLETLIAKRALMKMWQEKERKRADHPHMTSLGKEWDITTLNPFWNVSTQPQQLPRPQ
QVSDATTVGNHLQQKRSQLFWDLPSLNSESLATTVWVSRNPSSQNAHSVPLDKASTSLPG
EPEVEASSQLSQAPPQPHHMAQPQHFTPAWPQSQPPPLAEIQTQAHLSPPVPSLGCSSPP
QIRGCGASYPTSQERTQSVIPTGKEYLEWPLKKRPKWKRVLPSLLKKSQAVLSQPTAHLP
QERPASWSPKSAPILPGVVTSPELPEHWWQGRNAIHQEQSCGPPSRLQASGDLLQPDGEF
PGRPQSQAEDTQQALLPSQPSDFAGKGRKDVQKTGFRSSGRFSDKGCLGSKLGPDPSRDQ
GSGRTSVKALDEDKEAEGDLRRSWKYQSVSSTPRDPDKEHLENKLQIHLARKVGEIKEGW
IPMPVRRSWLMAKCAVPKSDTHRKPGKLASWRGGKAHVNTSQELSFLHPCTQQILEVHLV
RFCVRHSWGTDLQSLEPINVWSGEAQAPPFPQSTFTPWASWVSRVESVPKVPIFLGKRPQ
NGPGDNRTTSKSVPTVSGPLAAPPPEQEGVQRPPRGSQSADTHGRSEAFPTGHKGRGCSQ
PPTCSLVGRTWQSRTVLESGKPKPRLEGSMGSEMAGNEAWLESESMSPGDPCSSRALQVL
SIGSQWARAEDALQALKVGEKPPTWEVTLGASVRASSGSVQEDLRSTGALGTTGNPSASS
VCVAQDPEQLHLKAQVVSEIALIVQVDSEEQLPGRAPGILLQDGATGLCLPGRHMDMLTA
ADRLPTQAPLSTSQSVSGKNMTASQGPCALLWKGGDSPGQQEPGSPKAKAPQKSQKTLGC
ADKGEAHRRPRTGEQGHRSKGPRTSEASGRSHPAQAREIGDKQERKYNQLQLEKGQTPPE
SHFQRKISHHPQGLHPRKGGTRWEDVLQKGKPGADAFQSWGSGPPRQFMDCMADKAWTIS
RVVGQILVDKLGLQWGRGPSEVNRHKGDFRAQENVPSCCHRGHCHQERSREMRALACSPK
ATPKGHHCPVKNRGIRDRDSSWAPPPREPVSPAGPHHHRPRMASTSGGPHPQLQELMSAQ
RCLAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4KFQ4	0.031	0.036	1.315E-3	1133	0.111	0.142	A0A0B4KFQ4.pdb.gz	A0A0B4KFQ4_DROME Alhambra, isoform O OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
2	AFDB:E1JJ76	0.040	0.043	4.611E-3	1165	0.113	0.141	E1JJ76.pdb.gz	E1JJ76_DROME Alhambra, isoform H OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
3	AFDB:A0A1D5NSI1	0.035	0.027	6.004E-3	1996	0.171	0.124	A0A1D5NSI1.pdb.gz
4	AFDB:O55103	0.029	0.030	1.326E-2	1391	0.170	0.177	O55103.pdb.gz	PRAX_MOUSE Periaxin OS=Mus musculus OX=10090 GN=Prx PE=1 SV=1
5	AFDB:G3V9G5	0.039	0.037	2.105E-2	1557	0.134	0.124	G3V9G5.pdb.gz	G3V9G5_RAT Synemin OS=Rattus norvegicus OX=10116 GN=Synm PE=1 SV=2
6	AFDB:Q9W523	0.046	0.044	3.342E-2	1537	0.134	0.126	Q9W523.pdb.gz	Q9W523_DROME Polyhomeotic distal, isoform A OS=Drosophila melanogaster OX=7227 GN=ph-d PE=4 SV=3
7	AFDB:Q8IK49	0.035	0.036	3.570E-2	1263	0.090	0.103	Q8IK49.pdb.gz	Q8IK49_PLAF7 EMP1-trafficking protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1478600 PE=4 SV=1
8	AFDB:F4J7T3	0.034	0.027	3.814E-2	1957	0.163	0.120	F4J7T3.pdb.gz	EAF1A_ARATH Chromatin modification-related protein EAF1 A OS=Arabidopsis thaliana OX=3702 GN=EAF1A PE=1 SV=1
9	AFDB:B7Z043	0.038	0.034	4.352E-2	1788	0.163	0.131	B7Z043.pdb.gz	B7Z043_DROME Myocardin-related transcription factor, isoform H OS=Drosophila melanogaster OX=7227 GN=Mrtf PE=4 SV=3
10	AFDB:Q9HCH0	0.038	0.040	4.352E-2	1334	0.172	0.187	Q9HCH0.pdb.gz	NCK5L_HUMAN Nck-associated protein 5-like OS=Homo sapiens OX=9606 GN=NCKAP5L PE=1 SV=4
11	PDB:7dvqR	0.024	0.113	5.068	241	0.017	0.100	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:5u0pQ	0.027	0.069	7.531	508	0.014	0.039	5u0pQ.pdb.gz
13	PDB:6yxyBJ	0.024	0.081	8.045	293	0.008	0.038	6yxyBJ.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
14	PDB:3j79F	0.037	0.101	9.181	390	0.010	0.038	3j79F.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IWB4	1.11e-131	443	1347	0.322	0.346	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
2	B6VQA5	1.39e-37	156	1048	0.107	0.147	SPT31_RAT Spermatogenesis-associated protein 31 OS=Rattus norvegicus OX=10116 GN=Spata31 PE=1 SV=1
3	A6NFR6	2.73e-27	117	353	0.088	0.360	CE060_HUMAN Uncharacterized protein C5orf60 OS=Homo sapiens OX=9606 GN=C5orf60 PE=1 SV=2
4	Q6ZU69	0.41	37.7	1335	0.018	0.019	S31F1_HUMAN Protein SPATA31F1 OS=Homo sapiens OX=9606 GN=SPATA31F1 PE=2 SV=4
5	A0A8I6AAN5	4.0	34.3	683	0.013	0.028	A0A8I6AAN5_RAT Fibulin-1 OS=Rattus norvegicus OX=10116 GN=Fbln1 PE=1 SV=1
6	Q08879	4.6	34.3	705	0.013	0.027	FBLN1_MOUSE Fibulin-1 OS=Mus musculus OX=10090 GN=Fbln1 PE=1 SV=2
7	B1WC21	5.4	33.9	685	0.013	0.028	B1WC21_RAT Fibulin-1 OS=Rattus norvegicus OX=10116 GN=Fbln1 PE=2 SV=1
8	A0A0G2JY81	5.6	33.9	695	0.013	0.027	A0A0G2JY81_RAT Fibulin-1 OS=Rattus norvegicus OX=10116 GN=Fbln1 PE=1 SV=1
9	D3ZQ25	7.1	33.5	655	0.013	0.029	D3ZQ25_RAT Fibulin-1 OS=Rattus norvegicus OX=10116 GN=Fbln1 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15371 DUF4599	1.1e-12	59.4	Domain of unknown function (DUF4599)
2	PF14650 FAM75	1.2e-112	388.9	FAM75 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322640

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354891	0.563	Protein FAM163A
2	9606.ENSP00000422338	0.517	Protein FAM173B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.801	cellular process
GO:0065007	0.792	biological regulation
GO:0050789	0.781	regulation of biological process
GO:0050794	0.774	regulation of cellular process
GO:0032501	0.493	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.986	cytoplasm
GO:0001669	0.982	acrosomal vesicle
GO:0005634	0.926	nucleus
GO:0016020	0.495	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]