StarFunc result for job id Q6ZUJ8

User Input

>input (805 residues)
MAASGVPRGCDILIVYSPDAEEWCQYLQTLFLSSRQVRSQKILTHRLGPEASFSAEDLSL
FLSTRCVVVLLSAELVQHFHKPALLPLLQRAFHPPHRVVRLLCGVRDSEEFLDFFPDWAH
WQELTCDDEPETYVAAVKKAISEDSGCDSVTDTEPEDEKVVSYSKQQNLPTVTSPGNLMV
VQPDRIRCGAETTVYVIVRCKLDDRVATEAEFSPEDSPSVRMEAKVENEYTISVKAPNLS
SGNVSLKIYSGDLVVCETVISYYTDMEEIGNLLSNAANPVEFMCQAFKIVPYNTETLDKL
LTESLKNNIPASGLHLFGINQLEEEDMMTNQRDEELPTLLHFAAKYGLKNLTALLLTCPG
ALQAYSVANKHGHYPNTIAEKHGFRDLRQFIDEYVETVDMLKSHIKEELMHGEEADAVYE
SMAHLSTDLLMKCSLNPGCDEDLYESMAAFVPAATEDLYVEMLQASTSNPIPGDGFSRAT
KDSMIRKFLEGNSMGMTNLERDQCHLGQEEDVYHTVDDDEAFSVDLASRPPVPVPRPETT
APGAHQLPDNEPYIFKVFAEKSQERPGNFYVSSESIRKGPPVRPWRDRPQSSIYDPFAGM
KTPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENLKRLRDSITRR
QREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRKSVIPPRTELRRGDWKTDSTS
STASSTSNRSSTRSLLSVSSGMEGDNEDNEVPEVTRSRSPGPPQVDGTPTMSLERPPRVP
PRAASQRPPTRETFHPPPPVPPRGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZUJ8	1.000	1.000	0.000	805	1.000	1.000	Q6ZUJ8.pdb.gz	BCAP_HUMAN Phosphoinositide 3-kinase adapter protein 1 OS=Homo sapiens OX=9606 GN=PIK3AP1 PE=1 SV=2
2	AFDB:Q9EQ32	0.619	0.615	0.000	811	0.850	0.843	Q9EQ32.pdb.gz	BCAP_MOUSE Phosphoinositide 3-kinase adapter protein 1 OS=Mus musculus OX=10090 GN=Pik3ap1 PE=1 SV=1
3	AFDB:Q9DDT2	0.516	0.518	9.175E-99	800	0.696	0.700	Q9DDT2.pdb.gz	BCAP_CHICK Phosphoinositide 3-kinase adapter protein 1 OS=Gallus gallus OX=9031 GN=PIK3AP1 PE=1 SV=1
4	AFDB:F1NBU2	0.262	0.286	1.780E-35	730	0.250	0.275	F1NBU2.pdb.gz
5	PDB:6xi2A	0.109	0.157	3.012E-5	528	0.057	0.087	6xi2A.pdb.gz	Crystal structures of beta-1,4-N-acetylglucosaminyltransferase 2: structural basis for inherited muscular dystrophies.
6	AFDB:P32521	0.076	0.047	2.373E-4	1480	0.137	0.074	P32521.pdb.gz	PAN1_YEAST Actin cytoskeleton-regulatory complex protein PAN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAN1 PE=1 SV=2
7	PDB:7anwA	0.141	0.172	2.928E-4	645	0.030	0.037	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
8	AFDB:Q18264	0.063	0.032	3.367E-4	1831	0.118	0.052	Q18264.pdb.gz	Q18264_CAEEL TMEM131_like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tmem-131 PE=1 SV=4
9	PDB:6vxkB	0.100	0.107	4.668E-4	747	0.012	0.013	6vxkB.pdb.gz
10	PDB:3j0aA	0.124	0.125	8.866E-4	797	0.024	0.024	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
11	PDB:3oaiA	0.086	0.134	1.333E-3	488	0.029	0.047	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
12	PDB:6okpN	0.090	0.513	1.498E-3	104	0.009	0.067	6okpN.pdb.gz	Broad and Potent Neutralizing Antibodies Recognize the Silent Face of the HIV Envelope.
13	PDB:7tvzE	0.085	0.101	1.785E-3	665	0.016	0.020	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
14	PDB:1f6lL	0.087	0.486	3.809E-3	106	0.012	0.094	1f6lL.pdb.gz
15	PDB:2khzA	0.120	0.444	4.038E-3	163	0.036	0.178	2khzA.pdb.gz
16	AFDB:F4J5A7	0.116	0.097	4.133E-3	987	0.102	0.083	F4J5A7.pdb.gz	F4J5A7_ARATH RNA recognition motif (RRM)-containing protein OS=Arabidopsis thaliana OX=3702 GN=At3g23900 PE=1 SV=1
17	PDB:4aizA	0.090	0.501	4.280E-3	107	0.011	0.084	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
18	AFDB:P0C6S7	0.083	0.057	5.864E-3	1260	0.101	0.064	P0C6S7.pdb.gz	ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus OX=10116 GN=Anks1b PE=1 SV=1
19	AFDB:Q9Y2G4	0.090	0.098	1.251E-2	727	0.101	0.111	Q9Y2G4.pdb.gz	ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ANKRD6 PE=2 SV=3
20	AFDB:O94763	0.046	0.065	1.995E-2	535	0.058	0.088	O94763.pdb.gz	RMP_HUMAN Unconventional prefoldin RPB5 interactor 1 OS=Homo sapiens OX=9606 GN=URI1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZUJ8	0.0	1671	805	1.000	1.000	BCAP_HUMAN Phosphoinositide 3-kinase adapter protein 1 OS=Homo sapiens OX=9606 GN=PIK3AP1 PE=1 SV=2
2	Q9DDT2	0.0	1043	800	0.698	0.703	BCAP_CHICK Phosphoinositide 3-kinase adapter protein 1 OS=Gallus gallus OX=9031 GN=PIK3AP1 PE=1 SV=1
3	Q9EQ32	0.0	1302	811	0.851	0.845	BCAP_MOUSE Phosphoinositide 3-kinase adapter protein 1 OS=Mus musculus OX=10090 GN=Pik3ap1 PE=1 SV=1
4	Q8NDB2	4.49e-39	157	785	0.150	0.154	BANK1_HUMAN B-cell scaffold protein with ankyrin repeats OS=Homo sapiens OX=9606 GN=BANK1 PE=1 SV=3
5	Q80VH0	1.63e-30	131	783	0.137	0.140	BANK1_MOUSE B-cell scaffold protein with ankyrin repeats OS=Mus musculus OX=10090 GN=Bank1 PE=1 SV=3
6	Q1WWH6	5.92e-17	88.2	1211	0.119	0.079	Q1WWH6_DROME RE42507p OS=Drosophila melanogaster OX=7227 GN=stumps PE=2 SV=1
7	Q9VFI0	6.87e-17	88.2	1220	0.122	0.080	Q9VFI0_DROME Stumps, isoform E OS=Drosophila melanogaster OX=7227 GN=stumps PE=4 SV=3
8	A0A0B4KFZ6	1.13e-16	87.4	1029	0.119	0.093	A0A0B4KFZ6_DROME Stumps, isoform D OS=Drosophila melanogaster OX=7227 GN=stumps PE=4 SV=1
9	A0A0B4KGP0	1.27e-16	87.0	973	0.122	0.101	A0A0B4KGP0_DROME Stumps, isoform F OS=Drosophila melanogaster OX=7227 GN=stumps PE=4 SV=1
10	Q9VFH9	1.66e-16	86.7	1012	0.119	0.095	Q9VFH9_DROME Stumps, isoform B OS=Drosophila melanogaster OX=7227 GN=stumps PE=4 SV=1
11	O96758	2.47e-16	86.3	1147	0.119	0.084	O96758_DROME Dof protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=stumps PE=2 SV=2
12	O96757	5.71e-16	85.1	1012	0.119	0.095	O96757_DROME Dof protein OS=Drosophila melanogaster OX=7227 GN=stumps PE=1 SV=1
13	E9Q394	1.08e-05	52.0	2776	0.030	0.009	AKP13_MOUSE A-kinase anchor protein 13 OS=Mus musculus OX=10090 GN=Akap13 PE=1 SV=1
14	F1M3G7	2.03e-05	50.8	2760	0.030	0.009	AKP13_RAT A-kinase anchor protein 13 OS=Rattus norvegicus OX=10116 GN=Akap13 PE=1 SV=2
15	Q12802	5.70e-05	49.7	2813	0.029	0.008	AKP13_HUMAN A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=2
16	F6P6M2	0.005	43.1	1753	0.037	0.017	F6P6M2_DANRE Rho guanine nucleotide exchange factor (GEF) 28a OS=Danio rerio OX=7955 GN=arhgef28 PE=4 SV=1
17	Q8N1W1	0.016	41.2	1705	0.022	0.011	ARG28_HUMAN Rho guanine nucleotide exchange factor 28 OS=Homo sapiens OX=9606 GN=ARHGEF28 PE=1 SV=3
18	Q18297	0.94	35.4	1211	0.031	0.021	TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans OX=6239 GN=trpa-1 PE=2 SV=5
19	P98187	1.1	35.0	520	0.025	0.038	CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens OX=9606 GN=CYP4F8 PE=1 SV=1
20	Q8VHI4	1.2	35.0	689	0.036	0.042	CARTF_MOUSE Calcium-responsive transcription factor OS=Mus musculus OX=10090 GN=Carf PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14545 DBB	6.7e-47	170.3	Dof, BCAP, and BANK (DBB) motif,
2	PF03938 OmpH	1.8e+02	13.8	Outer membrane protein (OmpH-like)
3	PF18567 TIR_3	1.1e-47	172.7	Toll/interleukin-1 receptor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339826

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364907	0.936	Tyrosine-protein kinase SYK
2	9606.ENSP00000428056	0.925	Phosphatidylinositol 3-kinase regulatory subunit alpha
3	9606.ENSP00000437940	0.880	B-lymphocyte antigen CD19
4	9606.ENSP00000262741	0.865	Phosphatidylinositol 3-kinase regulatory subunit gamma
5	9606.ENSP00000222254	0.862	Phosphatidylinositol 3-kinase regulatory subunit beta
6	9606.ENSP00000263967	0.856	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
7	9606.ENSP00000289153	0.844	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
8	9606.ENSP00000224337	0.840	B-cell linker protein
9	9606.ENSP00000366563	0.840	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
10	9606.ENSP00000376544	0.769	B-cell antigen receptor complex-associated protein beta chain
11	9606.ENSP00000376345	0.760	Growth factor receptor-bound protein 2
12	9606.ENSP00000221972	0.741	B-cell antigen receptor complex-associated protein alpha chain
13	9606.ENSP00000423602	0.697	Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
14	9606.ENSP00000387784	0.683	Son of sevenless homolog 1
15	9606.ENSP00000380921	0.681	SH3 domain-containing kinase-binding protein 1
16	9606.ENSP00000410294	0.675	Fibroblast growth factor receptor 2
17	9606.ENSP00000292408	0.673	Fibroblast growth factor receptor 4
18	9606.ENSP00000393312	0.673	Fibroblast growth factor receptor 1
19	9606.ENSP00000339824	0.671	Fibroblast growth factor receptor 3
20	9606.ENSP00000431254	0.671	Immunoglobulin lambda like polypeptide 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0051716	0.995	cellular response to stimulus
GO:0048583	0.991	regulation of response to stimulus
GO:0007165	0.985	signal transduction
GO:0050776	0.976	regulation of immune response
GO:0048522	0.968	positive regulation of cellular process
GO:0032101	0.955	regulation of response to external stimulus
GO:0002757	0.944	immune response-activating signaling pathway
GO:0002831	0.909	regulation of response to biotic stimulus
GO:0007166	0.899	cell surface receptor signaling pathway
GO:0009966	0.897	regulation of signal transduction
GO:0080134	0.880	regulation of response to stress
GO:0019222	0.868	regulation of metabolic process
GO:0031347	0.800	regulation of defense response
GO:0031323	0.744	regulation of cellular metabolic process
GO:1902531	0.740	regulation of intracellular signal transduction
GO:0002768	0.740	immune response-regulating cell surface receptor signaling pathway
GO:0009967	0.715	positive regulation of signal transduction
GO:1902533	0.712	positive regulation of intracellular signal transduction
GO:0045088	0.700	regulation of innate immune response
GO:0048519	0.690	negative regulation of biological process
GO:0002429	0.690	immune response-activating cell surface receptor signaling pathway
GO:0048523	0.679	negative regulation of cellular process
GO:0035556	0.601	intracellular signal transduction
GO:0032103	0.599	positive regulation of response to external stimulus
GO:0002218	0.519	activation of innate immune response
GO:0002758	0.498	innate immune response-activating signaling pathway
GO:0042221	0.487	response to chemical
GO:0065009	0.448	regulation of molecular function
GO:0070887	0.440	cellular response to chemical stimulus
GO:0002221	0.433	pattern recognition receptor signaling pathway
GO:0060255	0.410	regulation of macromolecule metabolic process
GO:0010033	0.403	response to organic substance
GO:0048585	0.390	negative regulation of response to stimulus
GO:0080090	0.372	regulation of primary metabolic process
GO:0050790	0.367	regulation of catalytic activity
GO:0009893	0.357	positive regulation of metabolic process
GO:0050727	0.340	regulation of inflammatory response
GO:0019220	0.330	regulation of phosphate metabolic process
GO:0071310	0.317	cellular response to organic substance
GO:0042325	0.316	regulation of phosphorylation
GO:0030522	0.316	intracellular receptor signaling pathway
GO:0032502	0.309	developmental process
GO:0009968	0.302	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.959	intracellular anatomical structure
GO:0005737	0.952	cytoplasm
GO:0005829	0.868	cytosol
GO:0043231	0.403	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]