StarFunc result for job id Q6ZUT3

User Input

>input (714 residues)
MLHLKVQFLDDSQKIFVVDQKSSGKALFNLSCSHLNLAEKEYFGLEFCSHSGNNVWLELL
KPITKQVKNPKEIVFKFMVKFFPVDPGHLREELTRYLFTLQIKKDLALGRLPCSDNCTAL
MVSHILQSELGDFHEETDRKHLAQTRYLPNQDCLEGKIMHFHQKHIGRSPAESDILLLDI
ARKLDMYGIRPHPASDGEGMQIHLAVAHMGVLVLRGNTKINTFNWAKIRKLSFKRKHFLI
KLHANILVLCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSFR
YSGRTQRQLLEYGRKGRLKSLPFERKHYPSQYHERQCRSSPDLLSDVSKQVEDLRLAYGG
GYYQNVNGVHASEPVLESRRRNSALEVTFATELEHSKPEADPTLLHQSQSSSSFPFIYMD
PVFNTEPNPNPDPRDIFSERSSLSSFQTSCKFSGNHMSIYSGLTSKVRPAKQLTYTDVPY
IPCTGQQVGIMPPQVFFYVDKPPQVPRWSPIRAEERTSPHSYVEPTAMKPAERSPRNIRM
KSFQQDLQVLQEAIARTSGRSNINVGLEEEDPNLEDAFVCNIQEQTPKRSQSQSDMKTIR
FPFGSEFRPLGPCPALSHKADLFTDMFAEQELPAVLMDQSTAERYVASESSDSESEILKP
DYYALYGKEIRSPMARIRLSSGSLQLDEEDEDAYFNTPTAEDRTSLKPCNYFLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZUT3	1.000	1.000	0.000	714	1.000	1.000	Q6ZUT3.pdb.gz	FRMD7_HUMAN FERM domain-containing protein 7 OS=Homo sapiens OX=9606 GN=FRMD7 PE=1 SV=1
2	AFDB:A2AD83	0.548	0.556	1.921E-94	703	0.852	0.865	A2AD83.pdb.gz	FRMD7_MOUSE FERM domain-containing protein 7 OS=Mus musculus OX=10090 GN=Frmd7 PE=1 SV=1
3	AFDB:B8JHS0	0.457	0.403	1.448E-47	811	0.343	0.302	B8JHS0.pdb.gz
4	AFDB:E9QIC8	0.458	0.320	2.002E-47	1025	0.310	0.216	E9QIC8.pdb.gz	E9QIC8_DANRE FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) OS=Danio rerio OX=7955 GN=farp1 PE=1 SV=1
5	AFDB:F1LYQ8	0.453	0.310	2.307E-45	1049	0.328	0.223	F1LYQ8.pdb.gz	FARP1_RAT FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Farp1 PE=1 SV=2
6	AFDB:O94887	0.451	0.307	2.142E-43	1054	0.301	0.204	O94887.pdb.gz	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
7	AFDB:Q91VS8	0.453	0.305	3.878E-43	1065	0.301	0.202	Q91VS8.pdb.gz	FARP2_MOUSE FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2
8	AFDB:O17905	0.446	0.295	4.380E-39	1091	0.294	0.192	O17905.pdb.gz	O17905_CAEEL Moesin/ezrin/radixin homolog 1 OS=Caenorhabditis elegans OX=6239 GN=frm-3 PE=1 SV=2
9	AFDB:E9PHY5	0.438	0.338	4.279E-34	935	0.252	0.193	E9PHY5.pdb.gz	E9PHY5_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
10	AFDB:G3V874	0.420	0.314	2.581E-32	963	0.262	0.194	G3V874.pdb.gz	G3V874_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=4 SV=1
11	PDB:4rm8A	0.354	0.664	1.402E-19	368	0.108	0.209	4rm8A.pdb.gz
12	PDB:6r9tA	0.185	0.067	8.814E-6	2185	0.048	0.016	6r9tA.pdb.gz
13	PDB:7c3mA	0.290	0.354	1.218E-5	577	0.073	0.090	7c3mA.pdb.gz
14	PDB:4gouA	0.121	0.161	8.786E-3	507	0.048	0.067	4gouA.pdb.gz
15	PDB:3tixA	0.109	0.384	1.590E-2	153	0.022	0.105	3tixA.pdb.gz
16	PDB:4f7zA	0.093	0.071	2.449E-2	946	0.028	0.021	4f7zA.pdb.gz
17	PDB:7vvbB	0.096	0.756	2.879E-2	77	0.017	0.156	7vvbB.pdb.gz	Structural insights into Ras regulation by SIN1.
18	PDB:7lq1A	0.101	0.077	3.770E-2	950	0.018	0.014	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
19	PDB:6u3eA	0.117	0.183	4.199E-2	397	0.027	0.048	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
20	PDB:6yvaC	0.094	0.384	4.199E-2	155	0.015	0.071	6yvaC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AD83	0.0	1218	703	0.852	0.865	FRMD7_MOUSE FERM domain-containing protein 7 OS=Mus musculus OX=10090 GN=Frmd7 PE=1 SV=1
2	Q6ZUT3	0.0	1489	714	1.000	1.000	FRMD7_HUMAN FERM domain-containing protein 7 OS=Homo sapiens OX=9606 GN=FRMD7 PE=1 SV=1
3	X6R7S7	0.0	1239	594	0.832	1.000	X6R7S7_HUMAN FERM domain containing 7 OS=Homo sapiens OX=9606 GN=FRMD7 PE=4 SV=1
4	F1LYQ8	2.76e-137	432	1049	0.297	0.202	FARP1_RAT FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Farp1 PE=1 SV=2
5	E9QIC8	1.49e-136	429	1025	0.277	0.193	E9QIC8_DANRE FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) OS=Danio rerio OX=7955 GN=farp1 PE=1 SV=1
6	Q9Y4F1	1.44e-128	409	1045	0.317	0.216	FARP1_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FARP1 PE=1 SV=1
7	O94887	2.51e-124	397	1054	0.262	0.177	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
8	Q91VS8	6.52e-124	397	1065	0.259	0.174	FARP2_MOUSE FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2
9	O17905	3.04e-92	312	1091	0.218	0.143	O17905_CAEEL Moesin/ezrin/radixin homolog 1 OS=Caenorhabditis elegans OX=6239 GN=frm-3 PE=1 SV=2
10	A0A8I5ZZJ7	1.71e-71	251	835	0.183	0.157	A0A8I5ZZJ7_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
11	A3E0T0	2.97e-71	251	870	0.183	0.151	A3E0T0_RAT Erythrocyte protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=2 SV=1
12	A0A8I5ZVK0	3.96e-71	251	888	0.183	0.148	A0A8I5ZVK0_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
13	A8K968	5.33e-71	248	756	0.183	0.173	A8K968_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
14	F7FPP7	5.77e-71	250	911	0.183	0.144	F7FPP7_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
15	Q9WV92	6.22e-71	251	929	0.183	0.141	E41L3_MOUSE Band 4.1-like protein 3 OS=Mus musculus OX=10090 GN=Epb41l3 PE=1 SV=1
16	A0A8I6AUN0	7.03e-71	250	902	0.183	0.145	A0A8I6AUN0_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
17	G3V874	7.67e-71	251	963	0.183	0.136	G3V874_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=4 SV=1
18	A0A8I5Y1G9	8.43e-71	250	933	0.183	0.140	A0A8I5Y1G9_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
19	A0A0G2K1Q9	8.89e-71	250	943	0.183	0.139	A0A0G2K1Q9_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=4 SV=2
20	Q9Z2H5	1.15e-70	249	879	0.183	0.149	E41L1_MOUSE Band 4.1-like protein 1 OS=Mus musculus OX=10090 GN=Epb41l1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08736 FA	8.3e-10	49.8	FERM adjacent (FA)
2	PF09380 FERM_C	1.8e-20	84.4	FERM C-terminal PH-like domain
3	PF00373 FERM_M	2.3e-07	42.6	FERM central domain
4	PF09379 FERM_N	7.3e-15	65.9	FERM N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298542

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367408	0.967	Peripheral plasma membrane protein CASK
2	9606.ENSP00000417161	0.865	G-protein coupled receptor 143
3	9606.ENSP00000340328	0.819	Nyctalopin
4	9606.ENSP00000359563	0.765	Cerebellar degeneration related protein 1
5	9606.ENSP00000477981	0.739	Brain mitochondrial carrier protein 1
6	9606.ENSP00000359940	0.731	Immunoglobulin superfamily member 1
7	9606.ENSP00000269321	0.704	Rho GDP-dissociation inhibitor 1
8	9606.ENSP00000353362	0.684	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
9	9606.ENSP00000262375	0.649	DnaJ homolog subfamily A member 3, mitochondrial
10	9606.ENSP00000439012	0.613	Acyl-CoA-binding protein
11	9606.ENSP00000265967	0.599	Hermansky-Pudlak syndrome 5 protein
12	9606.ENSP00000215855	0.584	Beta-crystallin B3
13	9606.ENSP00000262844	0.583	AMME syndrome candidate gene 1 protein
14	9606.ENSP00000359567	0.572	Transcription factor SOX-3
15	9606.ENSP00000360423	0.547	Voltage-dependent N-type calcium channel subunit alpha-1B
16	9606.ENSP00000274487	0.544	ADAM metallopeptidase with thrombospondin type 1 motif 19
17	9606.ENSP00000272647	0.543	AMMECR1-like protein
18	9606.ENSP00000356370	0.540	Protein crumbs homolog 1
19	9606.ENSP00000354878	0.503	Kinesin-like protein KIF21A
20	9606.ENSP00000234313	0.501	Pleckstrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0048583	0.788	regulation of response to stimulus
GO:0048518	0.788	positive regulation of biological process
GO:0010646	0.773	regulation of cell communication
GO:0023051	0.771	regulation of signaling
GO:0051128	0.761	regulation of cellular component organization
GO:0048522	0.758	positive regulation of cellular process
GO:0009987	0.750	cellular process
GO:0048519	0.716	negative regulation of biological process
GO:0032970	0.693	regulation of actin filament-based process
GO:0044087	0.657	regulation of cellular component biogenesis
GO:1902903	0.628	regulation of supramolecular fiber organization
GO:0048523	0.608	negative regulation of cellular process
GO:0032956	0.575	regulation of actin cytoskeleton organization
GO:0065009	0.574	regulation of molecular function
GO:0009966	0.548	regulation of signal transduction
GO:0032501	0.516	multicellular organismal process
GO:0110053	0.479	regulation of actin filament organization
GO:0031344	0.394	regulation of cell projection organization
GO:0051098	0.354	regulation of binding
GO:0050896	0.336	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.998	plasma membrane
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0031974	0.995	membrane-enclosed lumen
GO:0070013	0.994	intracellular organelle lumen
GO:0005829	0.992	cytosol
GO:0005634	0.989	nucleus
GO:0031981	0.959	nuclear lumen
GO:0005654	0.894	nucleoplasm
GO:0005576	0.882	extracellular region
GO:0005615	0.401	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]