StarFunc result for job id Q6ZV29

User Input

>input (1317 residues)
MEEEKDDSPQLTGIAVGALLALALVGVLILFMFRRLRQFRQAQPTPQYRFRKRDKVMFYG
RKIMRKVTTLPNTLVENTALPRQRARKRTKVLSLAKRILRFKKEYPALQPKEPPPSLLEA
DLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFLELCKHIVFVQLQEGEHVFQPREPDP
SICVVQDGRLEVCIQDTDGTEVVVKEVLAGDSVHSLLSILDIITGHAAPYKTVSVRAAIP
STILRLPAAAFHGVFEKYPETLVRVVQIIMVRLQRVTFLALHNYLGLTTELFNAESQAIP
LVSVASVAAGKAKKQVFYGEEERLKKPPRLQESCDSDHGGGRPAAAGPLLKRSHSVPAPS
IRKQILEELEKPGAGDPDPSAPQGGPGSATSDLGMACDRARVFLHSDEHPGSSVASKSRK
SVMVAEIPSTVSQHSESHTDETLASRKSDAIFRAAKKDLLTLMKLEDSSLLDGRVALLHV
PAGTVVSRQGDQDASILFVVSGLLHVYQRKIGSQEDTCLFLTRPGEMVGQLAVLTGEPLI
FTVKANRDCSFLSISKAHFYEIMRKQPTVVLGVAHTVVKRMSSFVRQIDFALDWVEVEAG
RAIYRQGDKSDCTYIMLSGRLRSVIRKDDGKKRLAGEYGRGDLVGVVETLTHQARATTVH
AVRDSELAKLPAGALTSIKRRYPQVVTRLIHLLGEKILGSLQQGPVTGHQLGLPTEGSKW
DLGNPAVNLSTVAVMPVSEEVPLTAFALELEHALSAIGPTLLLTSDNIKRRLGSAALDSV
HEYRLSSWLGQQEDTHRIVLYQADGTLTPWTQRCVRQADCILIVGLGDQEPTVGELERML
ESTAVRAQKQLILLHREEGPAPARTVEWLNMRSWCSGHLHLCCPRRVFSRRSLPKLVEMY
KHVFQRPPDRHSDFSRLARVLTGNAIALVLGGGGARGCAQVGVLKALAECGIPVDMVGGT
SIGAFVGALYSEERNYSQMRIRAKQWAEGMTSLMKAALDLTYPITSMFSGAGFNSSIFSV
FKDQQIEDLWIPYFAITTDITASAMRVHTDGSLWWYVRASMSLSGYMPPLCDPKDGHLLM
DGGYINNLPADVARSMGAKVVIAIDVGSRDETDLTNYGDALSGWWLLWKRWNPLATKVKV
LNMAEIQTRLAYVCCVRQLEVVKSSDYCEYLRPPIDSYSTLDFGKFNEICEVGYQHGRTV
FDIWGRSGVLEKMLRDQQGPSKKPASAVLTCPNASFTDLAEIVSRIEPAKPAMVDDESDY
QTEYEEELLDVPRDAYADFQSTSAQQGSDLEDESSLRHRHPSLAFPKLSEGSSDQDG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AJ88	0.849	0.827	0.000	1352	0.825	0.803	A2AJ88.pdb.gz	PLPL7_MOUSE Patatin-like phospholipase domain-containing protein 7 OS=Mus musculus OX=10090 GN=Pnpla7 PE=1 SV=1
2	AFDB:F1R844	0.835	0.820	0.000	1342	0.623	0.612	F1R844.pdb.gz	F1R844_DANRE Neuropathy target esterase isoform X3 OS=Danio rerio OX=7955 GN=pnpla6 PE=3 SV=1
3	AFDB:Q8IY17	0.774	0.742	0.000	1375	0.621	0.595	Q8IY17.pdb.gz	PLPL6_HUMAN Patatin-like phospholipase domain-containing protein 6 OS=Homo sapiens OX=9606 GN=PNPLA6 PE=1 SV=3
4	AFDB:Q9U969	0.726	0.673	0.000	1425	0.431	0.398	Q9U969.pdb.gz	SWS_DROME Neuropathy target esterase sws OS=Drosophila melanogaster OX=7227 GN=sws PE=1 SV=2
5	AFDB:Q8MVR1	0.095	0.052	2.316E-15	2631	0.078	0.039	Q8MVR1.pdb.gz	GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyostelium discoideum OX=44689 GN=gbpC PE=1 SV=1
6	AFDB:Q7KQK0	0.097	0.266	8.302E-15	441	0.051	0.152	Q7KQK0.pdb.gz	Q7KQK0_PLAF7 cAMP-dependent protein kinase regulatory subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1223100 PE=1 SV=1
7	PDB:5dykA	0.097	0.145	6.304E-14	809	0.062	0.101	5dykA.pdb.gz
8	PDB:3j4qB	0.084	0.260	1.136E-13	382	0.052	0.178	3j4qB.pdb.gz
9	AFDB:P30625	0.084	0.267	1.237E-13	366	0.047	0.169	P30625.pdb.gz	KAPR_CAEEL cAMP-dependent protein kinase regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=kin-2 PE=1 SV=3
10	AFDB:P16905	0.085	0.272	1.832E-13	376	0.043	0.152	P16905.pdb.gz	KAPR1_DROME cAMP-dependent protein kinase type I regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R1 PE=1 SV=2
11	AFDB:Q9HEW1	0.085	0.219	7.993E-13	459	0.054	0.155	Q9HEW1.pdb.gz	KAPR_CANAL cAMP-dependent protein kinase regulatory subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BCY1 PE=3 SV=1
12	PDB:6byrB	0.082	0.315	8.511E-13	288	0.043	0.194	6byrB.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
13	PDB:4dinB	0.084	0.279	1.612E-12	345	0.052	0.200	4dinB.pdb.gz	Localization and quaternary structure of the PKA RI Beta holoenzyme
14	PDB:4f7zA	0.086	0.118	1.612E-12	946	0.053	0.074	4f7zA.pdb.gz
15	AFDB:Q13237	0.082	0.136	4.683E-12	762	0.052	0.091	Q13237.pdb.gz	KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens OX=9606 GN=PRKG2 PE=1 SV=1
16	PDB:2byvE	0.086	0.121	8.559E-12	922	0.053	0.076	2byvE.pdb.gz
17	PDB:6wjfC	0.084	0.323	1.169E-8	295	0.040	0.180	6wjfC.pdb.gz
18	PDB:3i54D	0.094	0.487	1.569E-8	228	0.027	0.158	3i54D.pdb.gz	Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
19	PDB:6aunA	0.165	0.332	1.828E-7	618	0.036	0.078	6aunA.pdb.gz
20	PDB:3dkwA	0.091	0.472	2.708E-7	227	0.021	0.123	3dkwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384DVU0	0.0	1597	1365	0.628	0.606	A0A384DVU0_HUMAN Patatin like phospholipase domain containing 6 OS=Homo sapiens OX=9606 GN=PNPLA6 PE=1 SV=1
2	A2AJ88	0.0	2212	1352	0.825	0.803	PLPL7_MOUSE Patatin-like phospholipase domain-containing protein 7 OS=Mus musculus OX=10090 GN=Pnpla7 PE=1 SV=1
3	F1R844	0.0	1663	1342	0.627	0.615	F1R844_DANRE Neuropathy target esterase isoform X3 OS=Danio rerio OX=7955 GN=pnpla6 PE=3 SV=1
4	Q3TRM4	0.0	1601	1355	0.623	0.606	PLPL6_MOUSE Patatin-like phospholipase domain-containing protein 6 OS=Mus musculus OX=10090 GN=Pnpla6 PE=1 SV=2
5	Q5BK26	0.0	2172	1349	0.819	0.800	PLPL7_RAT Patatin-like phospholipase domain-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Pnpla7 PE=1 SV=2
6	Q8IY17	0.0	1594	1375	0.628	0.601	PLPL6_HUMAN Patatin-like phospholipase domain-containing protein 6 OS=Homo sapiens OX=9606 GN=PNPLA6 PE=1 SV=3
7	Q9U969	0.0	1041	1425	0.428	0.396	SWS_DROME Neuropathy target esterase sws OS=Drosophila melanogaster OX=7227 GN=sws PE=1 SV=2
8	Q9USJ4	1.44e-168	540	1316	0.285	0.285	NTE1_SCHPO Lysophospholipase NTE1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nte1 PE=3 SV=1
9	Q04958	2.34e-135	456	1679	0.216	0.169	NTE1_YEAST Lysophospholipase NTE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTE1 PE=1 SV=1
10	P9WIY7	7.90e-26	116	583	0.097	0.220	Y2565_MYCTU Uncharacterized NTE family protein Rv2565 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2565 PE=1 SV=1
11	Q9HYQ6	1.30e-22	107	728	0.072	0.130	Q9HYQ6_PSEAE Patatin-like protein, PlpD OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=plpD PE=1 SV=1
12	P05987	8.68e-09	61.2	327	0.038	0.153	KAPR_DICDI cAMP-dependent protein kinase regulatory subunit OS=Dictyostelium discoideum OX=44689 GN=pkaR PE=1 SV=1
13	P07278	7.16e-07	55.8	416	0.039	0.123	KAPR_YEAST cAMP-dependent protein kinase regulatory subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BCY1 PE=1 SV=4
14	Q9GPG5	1.11e-06	55.5	499	0.038	0.100	Q9GPG5_9TRYP Regulatory subunit of protein kinase A OS=Trypanosoma brucei OX=5691 GN=RSU PE=4 SV=1
15	P81900	1.63e-06	54.3	377	0.049	0.170	KAPR2_DROME cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R2 PE=1 SV=2
16	Q385V6	1.75e-06	54.7	499	0.038	0.100	Q385V6_TRYB2 Protein kinase A regulatory subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2210 PE=1 SV=1
17	Q9GU80	1.75e-06	54.7	499	0.038	0.100	Q9GU80_9TRYP Protein kinase A regulatory subunit OS=Trypanosoma brucei OX=5691 GN=PKA-R PE=1 SV=1
18	P00514	3.26e-06	53.5	380	0.049	0.168	KAP0_BOVIN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR1A PE=1 SV=2
19	P31321	3.32e-06	53.5	381	0.045	0.155	KAP1_HUMAN cAMP-dependent protein kinase type I-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1B PE=1 SV=4
20	Q9DBC7	4.13e-06	53.1	381	0.049	0.168	KAP0_MOUSE cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Mus musculus OX=10090 GN=Prkar1a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	5.2e-43	156.4	Cyclic nucleotide-binding domain
2	PF01734 Patatin	4.4e-17	74.5	Patatin-like phospholipase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384610

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368305	0.942	Glycerophosphocholine phosphodiesterase GPCPD1
2	9606.ENSP00000264005	0.940	Phosphatidylcholine-sterol acyltransferase
3	9606.ENSP00000320337	0.910	HRAS-like suppressor 3
4	9606.ENSP00000219345	0.880	Group XV phospholipase A2
5	9606.ENSP00000330442	0.845	Phospholipase B1, membrane-associated
6	9606.ENSP00000407509	0.840	Neuropathy target esterase
7	9606.ENSP00000320043	0.828	Acyl-protein thioesterase 1
8	9606.ENSP00000371886	0.826	JMJD7-PLA2G4B readthrough
9	9606.ENSP00000363638	0.804	Acyl-protein thioesterase 2
10	9606.ENSP00000396045	0.799	Cytosolic phospholipase A2 beta
11	9606.ENSP00000364243	0.796	Group IIF secretory phospholipase A2
12	9606.ENSP00000472546	0.793	Cytosolic phospholipase A2 gamma
13	9606.ENSP00000333142	0.781	85/88 kDa calcium-independent phospholipase A2
14	9606.ENSP00000362123	0.778	Group XIIB secretory phospholipase A2-like protein
15	9606.ENSP00000356436	0.777	Cytosolic phospholipase A2
16	9606.ENSP00000380442	0.775	Cytosolic phospholipase A2 zeta
17	9606.ENSP00000410804	0.764	Calcium-independent phospholipase A2-gamma
18	9606.ENSP00000290472	0.762	Cytosolic phospholipase A2 delta
19	9606.ENSP00000382434	0.751	Cytosolic phospholipase A2 epsilon
20	9606.ENSP00000364257	0.736	Group IIE secretory phospholipase A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004622	1.000	lysophospholipase activity
GO:0005488	0.930	binding
GO:0005515	0.624	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044255	0.986	cellular lipid metabolic process
GO:0006644	0.977	phospholipid metabolic process
GO:0016042	0.941	lipid catabolic process
GO:0046486	0.937	glycerolipid metabolic process
GO:0006650	0.915	glycerophospholipid metabolic process
GO:0044242	0.905	cellular lipid catabolic process
GO:0046503	0.903	glycerolipid catabolic process
GO:0046434	0.893	organophosphate catabolic process
GO:0006807	0.873	nitrogen compound metabolic process
GO:1901564	0.842	organonitrogen compound metabolic process
GO:0046470	0.517	phosphatidylcholine metabolic process
GO:0009395	0.510	phospholipid catabolic process
GO:0046475	0.415	glycerophospholipid catabolic process
GO:0050789	0.414	regulation of biological process
GO:0050794	0.355	regulation of cellular process
GO:0032501	0.341	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0012505	0.993	endomembrane system
GO:0005634	0.984	nucleus
GO:0005829	0.982	cytosol
GO:0005783	0.973	endoplasmic reticulum
GO:0031090	0.972	organelle membrane
GO:0005789	0.950	endoplasmic reticulum membrane
GO:0071944	0.566	cell periphery
GO:0043228	0.556	non-membrane-bounded organelle
GO:0005886	0.538	plasma membrane
GO:0043232	0.513	intracellular non-membrane-bounded organelle
GO:0070013	0.431	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15177	1.000	a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine
EC:3.1.1.5	1.000	lysophospholipase.

[back to server]