StarFunc result for job id Q6ZV65

User Input

>input (393 residues)
MADRRRRLRPGTLAPVREGVNCRSRCFTKHKNGLKFPTSLHSRQLVFPRKGLDDFRKGCP
PCTGLVTQVPVEGFLPQIYHRAPQLAPKKRQIKLLKEADVLSKLSPAQQARKAFLEDVEA
HLTPHPLALYLNLEEAMPIELLSKVLEVLDPDRKLEDTWAYCQDTRKGMKEPTKLLKKHS
TQVYLGPSKKTSVSNAGQWLYEEKPHKMDLLHENGPRPGLHENGISDIDEEFILKQFDID
YETKPSHDALHTMKLNQVPLELKRSVGLSKLQETEFFQKLGYERKLQKPQNPYKPKWVKM
RYGAWYLNPKLWKKQRVDEPLVDPEVSHKAQEENFKKELQEQEELLADLHGTVAFKDFIL
SRGYRTPRFLENMYIGKECKRACNKTPIKRTQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZV65	1.000	1.000	1.211E-63	393	1.000	1.000	Q6ZV65.pdb.gz	FA47E_HUMAN Protein FAM47E OS=Homo sapiens OX=9606 GN=FAM47E PE=1 SV=3
2	AFDB:Q8NA70	0.168	0.116	1.382E-10	645	0.369	0.225	Q8NA70.pdb.gz	FA47B_HUMAN Protein FAM47B OS=Homo sapiens OX=9606 GN=FAM47B PE=1 SV=2
3	AFDB:Q5JRC9	0.177	0.105	3.458E-9	791	0.275	0.137	Q5JRC9.pdb.gz	FA47A_HUMAN Protein FAM47A OS=Homo sapiens OX=9606 GN=FAM47A PE=1 SV=3
4	AFDB:P52160	0.082	0.079	1.989E-1	408	0.127	0.123	P52160.pdb.gz	MYCA_DANRE Transcriptional regulator Myc-A OS=Danio rerio OX=7955 GN=myca PE=2 SV=3
5	AFDB:Q09743	0.082	0.036	2.119E-1	1309	0.079	0.024	Q09743.pdb.gz	RICTR_SCHPO Target of rapamycin complex 2 subunit ste20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ste20 PE=1 SV=1
6	AFDB:Q24175	0.096	0.067	2.257E-1	649	0.130	0.079	Q24175.pdb.gz	Q24175_DROME Discontinuous actin hexagon OS=Drosophila melanogaster OX=7227 GN=dah PE=2 SV=1
7	AFDB:P06646	0.081	0.077	3.095E-1	414	0.155	0.147	P06646.pdb.gz	MYC_ONCMY Transcriptional regulator Myc (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=myc PE=3 SV=1
8	AFDB:Q90477	0.078	0.099	3.984E-1	275	0.092	0.131	Q90477.pdb.gz	MYOD1_DANRE Myoblast determination protein 1 homolog OS=Danio rerio OX=7955 GN=myod1 PE=1 SV=2
9	AFDB:Q5XLR4	0.095	0.117	7.978E-1	276	0.092	0.130	Q5XLR4.pdb.gz	BORE1_DANRE Borealin OS=Danio rerio OX=7955 GN=cdca8 PE=2 SV=2
10	AFDB:Q4QRE7	0.085	0.100	9.052E-1	327	0.127	0.153	Q4QRE7.pdb.gz
11	PDB:6gejS	0.070	0.099	4.543	208	0.056	0.106	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
12	PDB:7qsdo	0.067	0.167	4.839	122	0.038	0.123	7qsdo.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.
13	PDB:2l9qA	0.070	0.165	7.067	109	0.043	0.156	2l9qA.pdb.gz
14	PDB:3vh5A	0.073	0.223	7.528	100	0.020	0.080	3vh5A.pdb.gz
15	PDB:7pzyH	0.058	0.095	8.018	226	0.031	0.053	7pzyH.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
16	PDB:5nr5A	0.053	0.131	8.541	113	0.056	0.195	5nr5A.pdb.gz
17	PDB:2wj8N	0.056	0.058	9.097	378	0.028	0.029	2wj8N.pdb.gz	Crystal Structure of a Nucleocapsid-Like Nucleoprotein-RNA Complex of Respiratory Syncytial Virus
18	PDB:5z56v	0.037	0.066	9.097	167	0.023	0.054	5z56v.pdb.gz	Structure of the human activated spliceosome in three conformational states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZV65	0.0	811	393	1.000	1.000	FA47E_HUMAN Protein FAM47E OS=Homo sapiens OX=9606 GN=FAM47E PE=1 SV=3
2	Q5JRC9	4.66e-32	130	791	0.211	0.105	FA47A_HUMAN Protein FAM47A OS=Homo sapiens OX=9606 GN=FAM47A PE=1 SV=3
3	Q8NA70	3.26e-24	107	645	0.201	0.122	FA47B_HUMAN Protein FAM47B OS=Homo sapiens OX=9606 GN=FAM47B PE=1 SV=2
4	A0A0R4IKJ1	3.4	32.3	721	0.046	0.025	CAPAM_DANRE mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase OS=Danio rerio OX=7955 GN=pcif1 PE=1 SV=1
5	Q949X1	3.5	32.0	309	0.056	0.071	Q949X1_ARATH Glutamyl-tRNA (Gln) amidotransferase subunit C OS=Arabidopsis thaliana OX=3702 GN=DFR1 PE=1 SV=1
6	Q8CDG5	8.9	31.2	640	0.048	0.030	CRERF_MOUSE CREB3 regulatory factor OS=Mus musculus OX=10090 GN=Crebrf PE=2 SV=1
7	Q8IUR6	9.3	30.8	639	0.048	0.030	CRERF_HUMAN CREB3 regulatory factor OS=Homo sapiens OX=9606 GN=CREBRF PE=1 SV=2
8	Q0WRV2	9.4	30.8	591	0.061	0.041	Q0WRV2_ARATH Mitochondrial transcription termination factor family protein OS=Arabidopsis thaliana OX=3702 GN=MTERF16 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14642 FAM47	1.6e-32	124.6	FAM47 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000409423

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253079	0.651	Coiled-coil domain-containing protein 62
2	9606.ENSP00000264771	0.638	Endosomal/lysosomal potassium channel TMEM175
3	9606.ENSP00000265594	0.625	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial
4	9606.ENSP00000348459	0.586	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase
5	9606.ENSP00000346483	0.566	DDRGK domain-containing protein 1
6	9606.ENSP00000459451	0.548	Acyl-coenzyme A synthetase ACSM2A, mitochondrial
7	9606.ENSP00000264896	0.538	Lysosome membrane protein 2
8	9606.ENSP00000373566	0.530	Coiled-coil domain containing 158
9	9606.ENSP00000314499	0.523	Cyclin-G-associated kinase
10	9606.ENSP00000215095	0.519	Syntaxin-1B
11	9606.ENSP00000355589	0.512	Signal-induced proliferation-associated 1-like protein 2
12	9606.ENSP00000377814	0.503	Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008047	1.000	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0031323	0.983	regulation of cellular metabolic process
GO:0051247	0.983	positive regulation of protein metabolic process
GO:0031399	0.977	regulation of protein modification process
GO:0051641	0.975	cellular localization
GO:0031325	0.974	positive regulation of cellular metabolic process
GO:0008104	0.971	protein localization
GO:0010468	0.966	regulation of gene expression
GO:0016043	0.936	cellular component organization
GO:0031401	0.925	positive regulation of protein modification process
GO:0033365	0.912	protein localization to organelle
GO:0031056	0.739	regulation of histone modification
GO:0031058	0.734	positive regulation of histone modification
GO:0010628	0.733	positive regulation of gene expression
GO:0071168	0.688	protein localization to chromatin
GO:0031062	0.688	positive regulation of histone methylation
GO:0040029	0.684	epigenetic regulation of gene expression
GO:0006338	0.654	chromatin remodeling
GO:0045815	0.585	transcription initiation-coupled chromatin remodeling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0000785	0.995	chromatin
GO:0012505	0.493	endomembrane system
GO:0016020	0.453	membrane
GO:0070013	0.443	intracellular organelle lumen
GO:0042995	0.369	cell projection
GO:0120025	0.351	plasma membrane bounded cell projection
GO:0005856	0.349	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]