StarFunc result for job id Q6ZVD7

User Input

>input (989 residues)
MARPVQLAPGSLALVLCRLEAQKAAGAAEEPGGRAVFRAFRRANARCFWNARLARAASRL
AFQGWLRRGVLLVRAPPACLQVLRDAWRRRALRPPRGFRIRAVGDVFPVQMNPITQSQFV
PLGEVLCCAISDMNTAQIVVTQESLLERLMKHYPGIAIPSEDILYTTLGTLIKERKIYHT
GEGYFIVTPQTYFITNTTTQENKRMLPSDESRLMPASMTYLVSMESCAESAQENAAPISH
CQSCQCFRDMHTQDVQEAPVAAEVTRKSHRGLGESVSWVQNGAVSVSAEHHICESTKPLP
YTRDKEKGKKFGFSLLWRSLSRKEKPKTEHSSFSAQFPPEEWPVRDEDDLDNIPRDVEHE
IIKRINPILTVDNLIKHTVLMQKYEEQKKYNSQGTSTDMLTIGHKYPSKEGVKKRQGLSA
KPQGQGHSRRDRHKARNQGSEFQPGSIRLEKHPKLPATQPIPRIKSPNEMVGQKPLGEIT
TVLGSHLIYKKRISNPFQGLSHRGSTISKGHKIQKTSDLKPSQTGPKEKPFQKPRSLDSS
RIFDGKAKEPYAEQPNDKMEAESIYINDPTVKPINDDFRGHLFSHPQQSMLQNDGKCCPF
MESMLRYEVYGGENEVIPEVLRKSHSHFDKLGETKQTPHSLPSRGASFSDRTPSACRLVD
NTIHQFQNLGLLDYPVGVNPLRQAARQDKDSEELLRKGFVQDAETTSLENEQLSNDDQAL
YQNEVEDDDGACSSLYLEEDDISENDDLRQMLPGHSQYSFTGGSQGNHLGKQKVIERSLT
EYNSTMERVESQVLKRNECYKPTGLHATPGESQEPNLSAESCGLNSGAQFGFNYEEEPSV
AKCVQASAPADERIFDYYSARKASFEAEVIQDTIGDTGKKPASWSQSPQNQEMRKHFPQK
FQLFNTSHMPVLAQDVQYEHSHLEGTENHSMAGDSGIDSPRTQSLGSNNSVILDGLKRRQ
NFLQNVEGTKSSQPLTSNSLLPLTPVINV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Y5I4	0.107	0.096	0.000	1101	0.997	0.896	A0A2R8Y5I4.pdb.gz	A0A2R8Y5I4_HUMAN Storkhead box 1 OS=Homo sapiens OX=9606 GN=STOX1 PE=1 SV=1
2	AFDB:B2RQL2	0.256	0.256	2.776E-85	990	0.605	0.604	B2RQL2.pdb.gz	STOX1_MOUSE Storkhead-box protein 1 OS=Mus musculus OX=10090 GN=Stox1 PE=1 SV=1
3	AFDB:Q499E5	0.082	0.087	1.112E-19	926	0.237	0.253	Q499E5.pdb.gz	STOX2_MOUSE Storkhead-box protein 2 OS=Mus musculus OX=10090 GN=Stox2 PE=2 SV=2
4	AFDB:Q6AWN7	0.189	0.178	2.578E-19	1049	0.187	0.176	Q6AWN7.pdb.gz	Q6AWN7_DROME RE48574p OS=Drosophila melanogaster OX=7227 GN=ko PE=2 SV=1
5	AFDB:Q569L8	0.042	0.037	2.030E-2	1344	0.117	0.086	Q569L8.pdb.gz	CENPJ_MOUSE Centromere protein J OS=Mus musculus OX=10090 GN=Cenpj PE=2 SV=2
6	AFDB:B7Z043	0.047	0.031	2.155E-2	1788	0.122	0.068	B7Z043.pdb.gz	B7Z043_DROME Myocardin-related transcription factor, isoform H OS=Drosophila melanogaster OX=7227 GN=Mrtf PE=4 SV=3
7	AFDB:Q57UR3	0.046	0.048	3.281E-2	934	0.104	0.110	Q57UR3.pdb.gz	Q57UR3_TRYB2 C2H2-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.110 PE=3 SV=1
8	AFDB:Q9ESU6	0.055	0.043	5.304E-2	1400	0.123	0.087	Q9ESU6.pdb.gz	BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus OX=10090 GN=Brd4 PE=1 SV=2
9	AFDB:Q8WYQ9	0.041	0.043	7.604E-2	949	0.108	0.113	Q8WYQ9.pdb.gz	ZCH14_HUMAN Zinc finger CCHC domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZCCHC14 PE=1 SV=1
10	AFDB:A0A0B4LFW8	0.040	0.034	8.075E-2	1277	0.122	0.095	A0A0B4LFW8.pdb.gz	A0A0B4LFW8_DROME Thin, isoform E OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
11	PDB:3q08A	0.061	0.183	8.553E-2	241	0.026	0.108	3q08A.pdb.gz	Structural features promoting dioxygen production by Dechloromonas aromatica chlorite dismutase.
12	PDB:6ahrE	0.074	0.345	9.082E-2	147	0.024	0.163	6ahrE.pdb.gz	Cryo-EM Structure of the Human Ribonuclease P Holoenzyme.
13	PDB:6ttuC	0.063	0.088	1.155E-1	701	0.017	0.024	6ttuC.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
14	PDB:2xv4S	0.065	0.145	1.226E-1	399	0.013	0.033	2xv4S.pdb.gz
15	PDB:6w6vE	0.065	0.285	1.302E-1	169	0.015	0.089	6w6vE.pdb.gz	Cryo-EM structure of catalytic ribonucleoprotein complex RNase MRP.
16	PDB:7yziA	0.063	0.130	2.105E-1	378	0.026	0.069	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
17	PDB:7k5yU	0.059	0.659	2.842E-1	75	0.011	0.147	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
18	PDB:6v9iC	0.060	0.079	3.018E-1	730	0.014	0.019	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
19	PDB:5khrN	0.062	0.093	3.613E-1	645	0.016	0.025	5khrN.pdb.gz
20	PDB:7vo0G	0.050	0.297	4.074E-1	131	0.012	0.092	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y5I4	0.0	2061	1101	0.998	0.896	A0A2R8Y5I4_HUMAN Storkhead box 1 OS=Homo sapiens OX=9606 GN=STOX1 PE=1 SV=1
2	B2RQL2	0.0	1142	990	0.608	0.607	STOX1_MOUSE Storkhead-box protein 1 OS=Mus musculus OX=10090 GN=Stox1 PE=1 SV=1
3	Q6ZVD7	0.0	2068	989	1.000	1.000	STOX1_HUMAN Storkhead-box protein 1 OS=Homo sapiens OX=9606 GN=STOX1 PE=1 SV=2
4	Q499E5	6.41e-65	238	926	0.208	0.222	STOX2_MOUSE Storkhead-box protein 2 OS=Mus musculus OX=10090 GN=Stox2 PE=2 SV=2
5	Q9P2F5	1.39e-64	238	926	0.194	0.207	STOX2_HUMAN Storkhead-box protein 2 OS=Homo sapiens OX=9606 GN=STOX2 PE=2 SV=2
6	Q6AWN7	3.62e-31	134	1049	0.063	0.059	Q6AWN7_DROME RE48574p OS=Drosophila melanogaster OX=7227 GN=ko PE=2 SV=1
7	Q9VP79	3.68e-31	134	1049	0.063	0.059	Q9VP79_DROME FI21431p1 OS=Drosophila melanogaster OX=7227 GN=ko PE=2 SV=1
8	O18363	6.66e-31	133	882	0.063	0.070	O18363_DROME Knockout OS=Drosophila melanogaster OX=7227 GN=ko PE=2 SV=1
9	G5EEC5	5.80e-28	120	414	0.054	0.128	HAM1_CAEEL Stork-head box protein ham-1 OS=Caenorhabditis elegans OX=6239 GN=ham-1 PE=1 SV=1
10	Q9UNF1	2.4	34.3	606	0.020	0.033	MAGD2_HUMAN Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2
11	Q5H909	2.6	34.3	588	0.020	0.034	Q5H909_HUMAN MAGE family member D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2
12	P49772	2.7	33.5	232	0.024	0.103	FLT3L_MOUSE Fms-related tyrosine kinase 3 ligand OS=Mus musculus OX=10090 GN=Flt3lg PE=2 SV=1
13	Q3SZT6	3.1	33.1	196	0.037	0.189	FLTOP_BOVIN Protein Flattop OS=Bos taurus OX=9913 GN=CFAP126 PE=1 SV=1
14	O06614	9.7	32.3	473	0.027	0.057	O06614_MYCTU Probable PhiRv1 phage protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1576c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10264 Stork_head	6.1e-33	124.2	Winged helix Storkhead-box1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298596

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264607	0.709	Ankyrin repeat and SOCS box protein 1
2	9606.ENSP00000265872	0.708	Cell division cycle and apoptosis regulator protein 1
3	9606.ENSP00000224807	0.697	Sideroflexin-3
4	9606.ENSP00000376793	0.687	Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3
5	9606.ENSP00000450540	0.687	Alpha-1-antichymotrypsin
6	9606.ENSP00000316905	0.666	Sideroflexin-1
7	9606.ENSP00000263734	0.640	Endothelial PAS domain-containing protein 1
8	9606.ENSP00000356771	0.640	Coagulation factor V
9	9606.ENSP00000362687	0.636	ATP-dependent RNA helicase DDX50
10	9606.ENSP00000365048	0.627	Tumor necrosis factor ligand superfamily member 13B
11	9606.ENSP00000310670	0.594	Cell cycle and apoptosis regulator protein 2
12	9606.ENSP00000325425	0.584	Methionine adenosyltransferase 2 subunit beta
13	9606.ENSP00000356814	0.584	DDB1- and CUL4-associated factor 6
14	9606.ENSP00000480004	0.579	Epoxide hydrolase 1
15	9606.ENSP00000381607	0.575	Glutathione S-transferase P
16	9606.ENSP00000361405	0.566	Matrix metalloproteinase-9
17	9606.ENSP00000302665	0.560	Insulin-like growth factor I
18	9606.ENSP00000360973	0.536	Type-2 angiotensin II receptor
19	9606.ENSP00000302216	0.525	Protein atonal homolog 1
20	9606.ENSP00000371397	0.504	Protein FAM43A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0000977	0.956	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0048522	0.989	positive regulation of cellular process
GO:0009987	0.988	cellular process
GO:0051726	0.984	regulation of cell cycle
GO:0048583	0.973	regulation of response to stimulus
GO:0045787	0.841	positive regulation of cell cycle
GO:0050896	0.748	response to stimulus
GO:0019222	0.707	regulation of metabolic process
GO:0051173	0.701	positive regulation of nitrogen compound metabolic process
GO:0060255	0.699	regulation of macromolecule metabolic process
GO:0010604	0.692	positive regulation of macromolecule metabolic process
GO:0031323	0.685	regulation of cellular metabolic process
GO:0080090	0.683	regulation of primary metabolic process
GO:0031325	0.683	positive regulation of cellular metabolic process
GO:0051716	0.679	cellular response to stimulus
GO:0007346	0.564	regulation of mitotic cell cycle
GO:0009889	0.543	regulation of biosynthetic process
GO:0009966	0.536	regulation of signal transduction
GO:0010468	0.530	regulation of gene expression
GO:0019219	0.529	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.523	regulation of cellular biosynthetic process
GO:0090068	0.506	positive regulation of cell cycle process
GO:0010556	0.502	regulation of macromolecule biosynthetic process
GO:0051246	0.482	regulation of protein metabolic process
GO:0048519	0.454	negative regulation of biological process
GO:0006355	0.447	regulation of DNA-templated transcription
GO:0031399	0.442	regulation of protein modification process
GO:0042327	0.418	positive regulation of phosphorylation
GO:0065008	0.410	regulation of biological quality
GO:0001934	0.405	positive regulation of protein phosphorylation
GO:0043085	0.404	positive regulation of catalytic activity
GO:0051128	0.383	regulation of cellular component organization
GO:0048584	0.379	positive regulation of response to stimulus
GO:1901990	0.377	regulation of mitotic cell cycle phase transition
GO:0080134	0.374	regulation of response to stress
GO:0042221	0.371	response to chemical
GO:0070887	0.364	cellular response to chemical stimulus
GO:0006950	0.358	response to stress
GO:0006357	0.357	regulation of transcription by RNA polymerase II
GO:0033043	0.333	regulation of organelle organization
GO:0033554	0.332	cellular response to stress
GO:0033674	0.327	positive regulation of kinase activity
GO:0045859	0.319	regulation of protein kinase activity
GO:0045860	0.314	positive regulation of protein kinase activity
GO:0009892	0.309	negative regulation of metabolic process
GO:2000045	0.309	regulation of G1/S transition of mitotic cell cycle
GO:0051052	0.302	regulation of DNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.995	nucleoplasm
GO:0043228	0.985	non-membrane-bounded organelle
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0005730	0.946	nucleolus
GO:0001650	0.943	fibrillar center
GO:0005856	0.523	cytoskeleton
GO:0015630	0.511	microtubule cytoskeleton
GO:0071944	0.439	cell periphery
GO:0005815	0.337	microtubule organizing center
GO:0016020	0.307	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]