StarFunc result for job id Q6ZVD8

User Input

>input (1323 residues)
MKRNGSRNCLNRRSRFGSRERDWLREDVKRGCVYLYGADTTTATTTTTTSSSSSSSSSSS
DLHLVLCTVETPASEICAGEGRESLYLQLHGDLVRRLEPTERPLQIVYDYLSRLGFDDPV
RIQEEATNPDLGCMIRFYGEKPCHMDRLDRILLSGIYNVRKGKTQLHKWAERLVVLCGTC
LIVSSVKDCQTGKMHILPLVGGKIEEVKRRQYSLAFSSAGAQAQTYHVSFETLAEYQRWQ
RQASKVVSQRISTVDLSCYSLEEVPEHLFYSQDITYLNLRHNFMQLERPGGLDTLYKFSQ
LKGLNLSHNKLGLFPILLCEISTLTELNLSCNGFHDLPSQIGNLLNLQTLCLDGNFLTTL
PEELGNLQQLSSLGISFNNFSQIPEVYEKLTMLDRVVMAGNCLEVLNLGVLNRMNHIKHV
DLRMNHLKTMVIENLEGNKHITHVDLRDNRLTDLDLSSLCSLEQLHCGRNQLRELTLSGF
SLRTLYASSNRLTAVNVYPVPSLLTFLDLSRNLLECVPDWACEAKKIEVLDVSYNLLTEV
PVRILSSLSLRKLMLGHNHVQNLPTLVEHIPLEVLDLQHNALTRLPDTLFSKALNLRYLN
ASANSLESLPSACTGEESLSMLQLLYLTNNLLTDQCIPVLVGHLHLRILHLANNQLQTFP
ASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHSNNISIFPEILQLPQIQFVDL
SCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQKPLPTTDSTVT
STFWSHGLAEMAGQRNKLCVSALAMDSFAEGVGAVYGMFDGDRNEELPRLLQCTMADVLL
EEVQQSTNDTVFMANTFLVSHRKLGMAGQKLGSSALLCYIRPDTADPASSFSLTVANVGT
CQAVLCRGGKPVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYP
WILPKPHISSTPLTIQDELLILGNKALWEHLSYTEAVNAVRHVQDPLAAAKKLCTLAQSY
GCQDNVGAMVVYLNIGEEGCTCEMNGLTLPGPVGFASTTTIKDAPKPATPSSSSGIASEF
SSEMSTSEVSSEVGSTASDEHNAGGLDTALLPRPERRCSLHPTPTSGLFQRQPSSATFSS
NQSDNGLDSDDDQPVEGVITNGSKVEVEVDIHCCRGRDLENSPPLIESSPTLCSEEHARG
SCFGIRRQNSVNSGMLLPMSKDRMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVATE
VPKRKTGYFAAPTQMEPEDQFVVPHDLEEEVKEQMKQHQDSRLEPEPHEEDRTEPPEEFD
TAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A254	0.724	0.802	0.000	1190	0.825	0.917	D4A254.pdb.gz	D4A254_RAT PH domain and leucine rich repeat protein phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Phlpp2 PE=1 SV=4
2	AFDB:P70587	0.223	0.201	1.154E-17	1490	0.134	0.119	P70587.pdb.gz	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
3	AFDB:Q80TH2	0.237	0.225	2.171E-17	1402	0.130	0.123	Q80TH2.pdb.gz	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
4	PDB:7tvfD	0.261	0.603	2.844E-17	515	0.106	0.272	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
5	PDB:4oicB	0.174	0.722	3.112E-16	305	0.058	0.252	4oicB.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
6	PDB:4jndA	0.179	0.560	9.605E-13	408	0.043	0.140	4jndA.pdb.gz	Structural insight into Caenorhabditis elegans sex-determining protein FEM-2.
7	PDB:6gffI	0.275	0.585	2.478E-12	551	0.100	0.240	6gffI.pdb.gz
8	PDB:1a6qA	0.171	0.596	4.457E-12	363	0.038	0.138	1a6qA.pdb.gz	Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution.
9	PDB:7p5vB	0.172	0.268	2.710E-10	732	0.078	0.141	7p5vB.pdb.gz
10	PDB:7wv3A	0.253	0.440	3.889E-10	668	0.089	0.177	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
11	PDB:5nzzD	0.161	0.514	1.376E-9	379	0.042	0.148	5nzzD.pdb.gz	The TAB1-p38 alpha complex aggravates myocardial injury and can be targeted by small molecules.
12	PDB:7kprA	0.160	0.483	1.376E-9	403	0.040	0.132	7kprA.pdb.gz	Structural basis for the specificity of PPM1H phosphatase for Rab GTPases.
13	PDB:7wrqA	0.299	0.625	7.651E-9	566	0.098	0.230	7wrqA.pdb.gz
14	AFDB:Q8ND23	0.163	0.159	2.832E-6	1372	0.139	0.134	Q8ND23.pdb.gz	CARL3_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 3 OS=Homo sapiens OX=9606 GN=CARMIL3 PE=2 SV=2
15	AFDB:Q6F5E8	0.146	0.139	6.983E-5	1435	0.143	0.132	Q6F5E8.pdb.gz	CARL2_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2 PE=1 SV=2
16	AFDB:Q3V1M1	0.083	0.047	3.240E-4	2594	0.089	0.045	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
17	AFDB:A0A140LH27	0.069	0.056	7.985E-2	1664	0.029	0.023	A0A140LH27.pdb.gz	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
18	AFDB:P28006	0.043	0.063	1.311	793	0.038	0.063	P28006.pdb.gz	GAC1_YEAST Serine/threonine-protein phosphatase 1 regulatory subunit GAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAC1 PE=1 SV=2
19	AFDB:Q387U6	0.058	0.043	2.700	2399	0.088	0.049	Q387U6.pdb.gz	Q387U6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0660 PE=4 SV=1
20	AFDB:P98149	0.053	0.089	2.955	667	0.039	0.078	P98149.pdb.gz	DIF_DROME Dorsal-related immunity factor Dif OS=Drosophila melanogaster OX=7227 GN=Dif PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A0Z2	0.0	2196	1193	0.823	0.913	A0A8I6A0Z2_RAT PH domain and leucine rich repeat protein phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Phlpp2 PE=4 SV=1
2	D4A254	0.0	2439	1359	0.927	0.902	D4A254_RAT PH domain and leucine rich repeat protein phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Phlpp2 PE=1 SV=4
3	H3BMS5	0.0	2719	1358	1.000	0.974	H3BMS5_HUMAN PH domain and leucine rich repeat protein phosphatase 2 OS=Homo sapiens OX=9606 GN=PHLPP2 PE=1 SV=1
4	O60346	0.0	1336	1717	0.516	0.398	PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens OX=9606 GN=PHLPP1 PE=1 SV=3
5	Q6ZVD8	0.0	2721	1323	1.000	1.000	PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens OX=9606 GN=PHLPP2 PE=1 SV=3
6	Q8CHE4	0.0	1326	1687	0.511	0.401	PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus OX=10090 GN=Phlpp1 PE=1 SV=2
7	Q9WTR8	0.0	1329	1696	0.512	0.399	PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Phlpp1 PE=1 SV=1
8	Q9VJ07	2.36e-49	193	954	0.135	0.188	PHLPP_DROME Protein phosphatase PHLPP-like protein OS=Drosophila melanogaster OX=7227 GN=Phlpp PE=4 SV=1
9	A0A1D8PR83	1.07e-45	183	1690	0.169	0.133	A0A1D8PR83_CANAL Adenylate cyclase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CYR1 PE=3 SV=1
10	P14605	2.60e-39	162	1692	0.166	0.130	CYAA_SCHPO Adenylate cyclase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cyr1 PE=1 SV=1
11	P08678	8.02e-39	161	2026	0.172	0.112	CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYR1 PE=1 SV=2
12	Q9UQ13	4.15e-27	120	582	0.107	0.244	SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens OX=9606 GN=SHOC2 PE=1 SV=2
13	Q9VEK6	2.34e-26	118	641	0.105	0.217	SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster OX=7227 GN=Sur-8 PE=2 SV=3
14	Q96RT1	1.49e-25	117	1412	0.095	0.089	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
15	A0A8I6A8N1	4.26e-25	115	1295	0.093	0.095	A0A8I6A8N1_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
16	A0A8I6AE43	4.29e-25	116	1451	0.093	0.085	A0A8I6AE43_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
17	A0A8I6ACI5	5.00e-25	115	1364	0.093	0.090	A0A8I6ACI5_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
18	A0A8I5ZWX2	5.77e-25	115	1403	0.093	0.088	A0A8I5ZWX2_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
19	A0A8I5ZN42	6.68e-25	115	1230	0.093	0.100	A0A8I5ZN42_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
20	Q80TH2	1.56e-24	114	1402	0.093	0.088	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00560 LRR_1	58	15.6	Leucine Rich Repeat
2	PF12799 LRR_4	1.1e-25	100.3	Leucine Rich repeats (2 copies)
3	PF13516 LRR_6	3.5	19.0	Leucine Rich repeat
4	PF13855 LRR_8	3.2e-32	121.4	Leucine rich repeat
5	PF00169 PH	1.1e+02	14.8	PH domain
6	PF00481 PP2C	2.3e-24	98.0	Protein phosphatase 2C

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000457991

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000451828	0.989	RAC-alpha serine/threonine-protein kinase
2	9606.ENSP00000263826	0.981	RAC-gamma serine/threonine-protein kinase
3	9606.ENSP00000375892	0.969	RAC-beta serine/threonine-protein kinase
4	9606.ENSP00000262719	0.937	PH domain leucine-rich repeat-containing protein phosphatase 1
5	9606.ENSP00000307491	0.925	WD repeat-containing protein 48
6	9606.ENSP00000282344	0.897	Ubiquitin carboxyl-terminal hydrolase 12
7	9606.ENSP00000407818	0.819	Ubiquitin carboxyl-terminal hydrolase 46
8	9606.ENSP00000229922	0.818	Adenylyl cyclase-associated protein 2
9	9606.ENSP00000361883	0.818	Adenylyl cyclase-associated protein 1
10	9606.ENSP00000406084	0.802	WD repeat-containing protein 20
11	9606.ENSP00000307272	0.787	Regulatory-associated protein of mTOR
12	9606.ENSP00000343526	0.760	Ubiquitin carboxyl-terminal hydrolase 1
13	9606.ENSP00000361021	0.728	Phosphatase and tensin homolog
14	9606.ENSP00000367208	0.727	Protein SGT1 homolog
15	9606.ENSP00000262613	0.707	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
16	9606.ENSP00000357836	0.691	Sorting nexin-27
17	9606.ENSP00000408005	0.685	Na(+)/H(+) exchange regulatory cofactor NHE-RF2
18	9606.ENSP00000225577	0.672	Ribosomal protein S6 kinase beta-1
19	9606.ENSP00000264414	0.639	Cullin-3
20	9606.ENSP00000222330	0.630	Glycogen synthase kinase-3 alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004722	0.998	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0032501	0.939	multicellular organismal process
GO:0032502	0.935	developmental process
GO:0048856	0.931	anatomical structure development
GO:0007275	0.907	multicellular organism development
GO:0019538	0.898	protein metabolic process
GO:0036211	0.888	protein modification process
GO:0021766	0.874	hippocampus development
GO:0016311	0.832	dephosphorylation
GO:0006470	0.788	protein dephosphorylation
GO:0050794	0.487	regulation of cellular process
GO:0050896	0.325	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005829	0.996	cytosol
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0005886	0.990	plasma membrane
GO:0005856	0.910	cytoskeleton
GO:0042995	0.698	cell projection
GO:0120025	0.673	plasma membrane bounded cell projection
GO:0031090	0.654	organelle membrane
GO:0005929	0.620	cilium
GO:0015630	0.609	microtubule cytoskeleton
GO:0098590	0.592	plasma membrane region
GO:0098588	0.584	bounding membrane of organelle
GO:0043005	0.530	neuron projection
GO:0001917	0.470	photoreceptor inner segment
GO:0097730	0.455	non-motile cilium
GO:0097733	0.448	photoreceptor cell cilium
GO:0001750	0.429	photoreceptor outer segment
GO:0005819	0.394	spindle
GO:0031253	0.369	cell projection membrane
GO:0060170	0.344	ciliary membrane
GO:0042622	0.318	photoreceptor outer segment membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	0.998	protein-serine/threonine phosphatase.

[back to server]