StarFunc result for job id Q6ZVH7

User Input

>input (1005 residues)
MEKQRALVAAKDGDVATLERLLEAGALGPGITDALGAGLVHHATRAGHLDCVKFLVQRAQ
LPGNQRAHNGATPAHDAAATGSLAELCWLVREGGCGLQDQDASGVSPLHLAARFGHPVLV
EWLLHEGHSATLETREGARPLHHAAVSGDLTCLKLLTAAHGSSVNRRTRSGASPLYLACQ
EGHLHLAQFLVKDCGADVHLRALDGMSALHAAAARGHYSLVVWLVTFTDIGLTARDNEGA
TALHFAARGGHTPILDRLLLMGTPILRDSWGGTPLHDAAENGQMECCQTLVSHHVDPSLR
DEDGYTAADLAEYHGHRDCAQYLREVAQPVPLLMTPPPPPFPPPPLLATRRSLEDGRRGG
PGPGNPSPMSLSPAWPGHPDQPLPREQMTSPAPPRIITSATADPEGTETALAGDTSDGLA
ALQLDGLPSGDIDGLVPTRDERGQPIPEWKRQVMVRKLQARLGAESSAEAQDNGGSSGPT
EQAAWRYSQTHQAILGPFGELLTEDDLVYLEKQIADLQLRRRCQEYESELGRLAAELQAL
LPEPLVSITVNSHFLPRAPGLEVEEASIPAAEPAGSAEASEVAPGVQPLPFWCSHISRLV
RSLSLLLKGVHGLVQGDEKPSTRPLQDTCREASASPPRSEAQRQIQEWGVSVRTLRGNFE
SASGPLCGFNPGPCEPGAQHRQCLSGCWPALPKPRSGLASGEPRPGDTEEASDSGISCEE
VPSEAGAAAGPDLASLRKERIIMLFLSHWRRSAYTPALKTVACRTLGARHAGLRGQEAAR
SPGPPSPPSEGPRLGHLWQQRSTITHLLGNWKAIMAHVPARQLRRLSRQPRGALSPEQFL
PHVDGAPVPYSSLSLDLFMLGYFQLLECDLPAEERKLRHLLCFEVFEHLGTHGWEAVRAF
HKAVTDEVAAGRRAWTDGFEDIKARFFGSSQRPAWDTEPGRKSGLTLLGPLPHAAVPCSG
PEPTAQRLGSRSQQGSFNGEDICGYINRSFAFWKEKEAEMFNFGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZVH7	1.000	1.000	0.000	1005	1.000	1.000	Q6ZVH7.pdb.gz	ESPNL_HUMAN Espin-like protein OS=Homo sapiens OX=9606 GN=ESPNL PE=1 SV=3
2	AFDB:Q3UYR4	0.348	0.348	3.068E-91	1005	0.795	0.795	Q3UYR4.pdb.gz	ESPNL_MOUSE Espin-like protein OS=Mus musculus OX=10090 GN=Espnl PE=1 SV=1
3	AFDB:B0S4T8	0.332	0.227	1.237E-52	1476	0.445	0.303	B0S4T8.pdb.gz
4	AFDB:B1AK53	0.320	0.376	3.075E-31	854	0.277	0.326	B1AK53.pdb.gz	ESPN_HUMAN Espin OS=Homo sapiens OX=9606 GN=ESPN PE=1 SV=1
5	AFDB:Q63618	0.320	0.384	3.229E-30	837	0.259	0.311	Q63618.pdb.gz	ESPN_RAT Espin OS=Rattus norvegicus OX=10116 GN=Espn PE=1 SV=2
6	AFDB:Q9ET47	0.329	0.378	8.146E-30	871	0.266	0.307	Q9ET47.pdb.gz	ESPN_MOUSE Espin OS=Mus musculus OX=10090 GN=Espn PE=1 SV=2
7	AFDB:Q3KP44	0.268	0.422	4.751E-15	614	0.129	0.212	Q3KP44.pdb.gz	ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens OX=9606 GN=ANKRD55 PE=1 SV=3
8	AFDB:A0A0G2K916	0.284	0.115	5.988E-15	2615	0.157	0.060	A0A0G2K916.pdb.gz	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
9	AFDB:Q9Y2G4	0.228	0.310	1.027E-14	727	0.141	0.195	Q9Y2G4.pdb.gz	ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ANKRD6 PE=2 SV=3
10	PDB:8cs9A	0.291	0.363	1.210E-14	796	0.091	0.114	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
11	AFDB:Q9VJ14	0.265	0.254	1.586E-13	1049	0.096	0.092	Q9VJ14.pdb.gz	Q9VJ14_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=mib2 PE=1 SV=1
12	PDB:5vkqA	0.248	0.175	8.821E-12	1499	0.100	0.067	5vkqA.pdb.gz
13	PDB:4oauC	0.260	0.370	2.248E-10	692	0.082	0.118	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:1wg0A	0.197	0.769	6.947E-9	243	0.056	0.230	1wg0A.pdb.gz
15	PDB:2dvwA	0.176	0.607	8.105E-9	229	0.061	0.266	2dvwA.pdb.gz
16	PDB:6aunA	0.202	0.301	1.502E-8	618	0.074	0.120	6aunA.pdb.gz
17	PDB:6v9hC	0.213	0.735	6.753E-8	270	0.062	0.230	6v9hC.pdb.gz
18	PDB:6pqpA	0.170	0.272	2.008E-6	615	0.048	0.078	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
19	PDB:6jd6B	0.153	0.762	3.314E-6	192	0.042	0.219	6jd6B.pdb.gz
20	PDB:6v9xA	0.169	0.290	5.471E-6	571	0.056	0.098	6v9xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UYR4	0.0	1515	1005	0.793	0.793	ESPNL_MOUSE Espin-like protein OS=Mus musculus OX=10090 GN=Espnl PE=1 SV=1
2	Q6ZVH7	0.0	2024	1005	1.000	1.000	ESPNL_HUMAN Espin-like protein OS=Homo sapiens OX=9606 GN=ESPNL PE=1 SV=3
3	B0S4T9	1.75e-114	375	873	0.183	0.211	B0S4T9_DANRE Espin OS=Danio rerio OX=7955 GN=si:dkey-77h17.1 PE=4 SV=1
4	Q9ET47	2.44e-111	367	871	0.180	0.208	ESPN_MOUSE Espin OS=Mus musculus OX=10090 GN=Espn PE=1 SV=2
5	Q63618	1.44e-108	358	837	0.177	0.213	ESPN_RAT Espin OS=Rattus norvegicus OX=10116 GN=Espn PE=1 SV=2
6	B1AK53	2.82e-107	355	854	0.184	0.217	ESPN_HUMAN Espin OS=Homo sapiens OX=9606 GN=ESPN PE=1 SV=1
7	Q54KA7	4.47e-33	140	986	0.097	0.098	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
8	Q9VX60	8.54e-29	127	1436	0.067	0.047	Q9VX60_DROME Forked, isoform B OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=2
9	Q24341	8.58e-29	127	1408	0.067	0.048	Q24341_DROME Large Forked protein OS=Drosophila melanogaster OX=7227 GN=f PE=2 SV=2
10	M9MSB3	9.43e-29	127	1761	0.067	0.038	M9MSB3_DROME Forked, isoform J OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=1
11	M9MSB2	1.19e-28	127	1790	0.067	0.037	M9MSB2_DROME Forked, isoform H OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=1
12	O70511	1.26e-28	127	2622	0.100	0.039	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
13	G5E8K5	3.42e-28	125	1961	0.101	0.052	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
14	P57078	7.13e-28	123	832	0.106	0.129	RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=RIPK4 PE=1 SV=1
15	Q9H4D1	1.49e-27	122	784	0.106	0.136	Q9H4D1_HUMAN Protein kinase OS=Homo sapiens OX=9606 GN=dik PE=2 SV=1
16	Q24241	1.57e-27	123	1549	0.097	0.063	Q24241_DROME Ankyrin OS=Drosophila melanogaster OX=7227 GN=Ank PE=4 SV=1
17	Q0KIE7	1.58e-27	123	1549	0.097	0.063	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
18	A0A5F9ZH38	2.02e-27	123	1739	0.105	0.061	A0A5F9ZH38_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	P16157	3.24e-27	122	1881	0.097	0.052	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
20	A0A0G2KBB9	4.12e-27	122	4017	0.105	0.026	A0A0G2KBB9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.2e-17	73.3	Ankyrin repeat
2	PF12796 Ank_2	4e-44	160.4	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	4.1e-22	86.7	Ankyrin repeat
4	PF13637 Ank_4	2.8e-37	137.9	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2.3e-27	106.0	Ankyrin repeats (many copies)
6	PF13916 Phostensin_N	1.4e+02	14.3	PP1-regulatory protein, Phostensin N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339115

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386213	0.725	Myosin-IIIb
2	9606.ENSP00000265944	0.703	Myosin-IIIa
3	9606.ENSP00000354483	0.701	Inactive dual specificity phosphatase 27
4	9606.ENSP00000340609	0.700	Dual specificity phosphatase DUPD1
5	9606.ENSP00000362728	0.700	Importin subunit alpha-7
6	9606.ENSP00000412130	0.698	Protein MRVI1
7	9606.ENSP00000264428	0.695	Glycine receptor subunit beta
8	9606.ENSP00000261800	0.692	Protocadherin Fat 2
9	9606.ENSP00000309163	0.691	CAAX prenyl protease 2
10	9606.ENSP00000307636	0.656	MORN repeat-containing protein 4
11	9606.ENSP00000468782	0.654	Zinc finger and BTB domain-containing protein 7C
12	9606.ENSP00000334665	0.637	Fascin-2
13	9606.ENSP00000243389	0.634	Proton-coupled amino acid transporter 1
14	9606.ENSP00000261637	0.604	Small subunit processome component 20 homolog
15	9606.ENSP00000282249	0.601	Guanylate cyclase soluble subunit alpha-2
16	9606.ENSP00000348163	0.590	Plastin-3
17	9606.ENSP00000382670	0.588	Glutaredoxin domain-containing cysteine-rich protein 1
18	9606.ENSP00000384312	0.567	TRIO and F-actin-binding protein
19	9606.ENSP00000274673	0.556	Protein FAM217A
20	9606.ENSP00000323928	0.556	Olfactory receptor 8H3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.836	cytoskeletal protein binding
GO:0003779	0.797	actin binding
GO:0044877	0.706	protein-containing complex binding
GO:0051015	0.586	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.980	multicellular organismal process
GO:0007600	0.841	sensory perception
GO:0007605	0.816	sensory perception of sound
GO:0065007	0.573	biological regulation
GO:0050789	0.561	regulation of biological process
GO:0009987	0.553	cellular process
GO:0050794	0.431	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	1.000	organelle
GO:0005737	1.000	cytoplasm
GO:0005829	0.986	cytosol
GO:0042995	0.964	cell projection
GO:0043229	0.946	intracellular organelle
GO:0120025	0.927	plasma membrane bounded cell projection
GO:0016020	0.901	membrane
GO:0043227	0.825	membrane-bounded organelle
GO:0098858	0.762	actin-based cell projection
GO:0098862	0.682	cluster of actin-based cell projections
GO:0043005	0.661	neuron projection
GO:0032421	0.650	stereocilium bundle
GO:0032420	0.585	stereocilium
GO:0043231	0.526	intracellular membrane-bounded organelle
GO:0043232	0.475	intracellular non-membrane-bounded organelle
GO:0071944	0.433	cell periphery
GO:0005886	0.390	plasma membrane
GO:0032426	0.328	stereocilium tip

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]