StarFunc result for job id Q6ZVL6

User Input

>input (1849 residues)
MDHTASQNAQDLIGIPHLGVSGSSTKWHSELSPTEGPHSAGSSTPGFLSPMAELSHPSPP
PPALGSLLQLPDGSPSWSMLEVASGPASTQQIKAGVPGRVHNGVSLPTFKNTETATHEAE
PPLFQTAESGAIEMTSRKLASATANDSANPLHLSAAPENSRGPALSAEHTSSLVPSLHIT
TLGQEQAILSGAVPASPSTGTADFPSILTFLQPTENHASPSPVPEMPTLPAEGSDGSPPA
TRDLLLSSKVPNLLSTSWTFPRWKKDSVTAILGKNEEANVTIPLQAFPRKEVLSLHTVNG
FVSDFSTGSVSSPIITAPRTNPLPSGPPLPSILSIQATQTVFPSLGFSSTKPEAYAAAVD
HSGLPASASKQVRASPSSMDVYDSLTIGDMKKPATTDVFWSSLSAETGSLSTESIISGLQ
QQTNYDLNGHTISTTSWETHLAPTAPPNGLTSAADAIKSQDFKDTAGHSVTAEGFSIQDL
VLGTSIEQPVQQSDMTMVGSHIDLWPTSNNNHSRDFQTAEVAYYSPTTRHSVSHPQLQLP
NQPAHPLLLTSPGPTSTGSLQEMLSDGTDTGSEISSDINSSPERNASTPFQNILGYHSAA
ESSISTSVFPRTSSRVLRASQHPKKWTADTVSSKVQPTAAAAVTLFLRKSSPPALSAALV
AKGTSSSPLAVASGPAKSSSMTTLAKNVTNKAASGPKRTPGAVHTAFPFTPTYMYARTGH
TTSTHTAMQGNMDTASGLLSTTYLPRKPQAMHTGLPNPTNLEMPRASTPRPLTVTAALTS
ITASVKATRLPPLRAENTDAVLPAASAAVVTTGKMASNLECQMSSKLLVKTVLFLTQRRV
QISESLKFSIAKGLTQALRKAFHQNDVSAHVDILEYSHNVTVGYYATKGKLVYLPAVVIE
MLGVYGVSNVTADLKQHTPHLQSVAVLASPWNPQPAGYFQLKTVLQFVSQADNIQSCKFA
QTMEQRLQKAFQDAERKVLNTKSNLTIQIVSTSNASQAVTLVYVVGNQSTFLNGTVASSL
LSQLSAELVGFYLTYPPLTIAEPLEYPNLDISETTRDYWVITVLQGVDNSLVGLHNQSFA
RVMEQRLAQLFMMSQQQGRRFKRATTLGSYTVQMVKMQRVPGPKDPAELTYYTLYNGKPL
LGTAAAKILSTIDSQRMALTLHHVVLLQADPVVKNPPNNLWIIAAVLAPIAVVTVIIIII
TAVLCRKNKNDFKPDTMINLPQRAKPVQGFDYAKQHLGQQGADEEVIPVTQETVVLPLPI
RDAPQERDVAQDGSTIKTAKSTETRKSRSPSENGSVISNESGKPSSGRRSPQNVMAQQKV
TKEEARKRNVPASDEEEGAVLFDNSSKVAAEPFDTSSGSVQLIAIKPTALPMVPPTSDRS
QESSAVLNGEVNKALKQKSDIEHYRNKLRLKAKRKGYYDFPAVETSKGLTERKKMYEKAP
KEMEHVLDPDSELCAPFTESKNRQQMKNSVYRSRQSLNSPSPGETEMDLLVTRERPRRGI
RNSGYDTEPEIIEETNIDRVPEPRGYSRSRQVKGHSETSTLSSQPSIDEVRQQMHMLLEE
AFSLASAGHAGQSRHQEAYGSAQHLPYSEVVTSAPGTMTRPRAGVQWVPTYRPEMYQYSL
PRPAYRFSQLPEMVMGSPPPPVPPRTGPVAVASLRRSTSDIGSKTRMAESTGPEPAQLHD
SASFTQMSRGPVSVTQLDQSALNYSGNTVPAVFAIPAANRPGFTGYFIPTPPSSYRNQAW
MSYAGENELPSQWADSVPLPGYIEAYPRSRYPQSSPSRLPRQYSQPANLHPSLEQAPAPS
TAASQQSLAENDPSDAPLTNISTAALVKAIREEVAKLAKKQTDMFEFQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q68FD9	0.184	0.176	4.082E-61	1940	0.258	0.246	Q68FD9.pdb.gz	K1549_MOUSE UPF0606 protein KIAA1549 OS=Mus musculus OX=10090 GN=Kiaa1549 PE=1 SV=3
2	AFDB:Q9HCM3	0.186	0.178	7.662E-60	1950	0.249	0.236	Q9HCM3.pdb.gz	K1549_HUMAN UPF0606 protein KIAA1549 OS=Homo sapiens OX=9606 GN=KIAA1549 PE=1 SV=4
3	AFDB:Q6N021	0.044	0.043	3.087E-7	2002	0.139	0.128	Q6N021.pdb.gz	TET2_HUMAN Methylcytosine dioxygenase TET2 OS=Homo sapiens OX=9606 GN=TET2 PE=1 SV=3
4	AFDB:M9NFI9	0.040	0.036	4.093E-7	2148	0.151	0.130	M9NFI9.pdb.gz	M9NFI9_DROME Spinophilin, isoform J OS=Drosophila melanogaster OX=7227 GN=Spn PE=1 SV=1
5	AFDB:D4AC33	0.042	0.041	6.426E-7	1920	0.143	0.138	D4AC33.pdb.gz	D4AC33_RAT Methylcytosine dioxygenase TET OS=Rattus norvegicus OX=10116 GN=Tet2 PE=3 SV=2
6	AFDB:Q6FUJ4	0.052	0.073	1.009E-6	1185	0.104	0.162	Q6FUJ4.pdb.gz	Q6FUJ4_CANGA Candida glabrata strain CBS138 chromosome F complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0F03003g PE=4 SV=1
7	AFDB:Q9W283	0.036	0.042	6.487E-6	1329	0.109	0.152	Q9W283.pdb.gz	Q9W283_DROME Arc, isoform A OS=Drosophila melanogaster OX=7227 GN=a PE=2 SV=2
8	AFDB:Q8I3S3	0.043	0.042	7.682E-6	1894	0.091	0.089	Q8I3S3.pdb.gz	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1
9	AFDB:A1ZAV3	0.062	0.057	2.511E-5	2171	0.149	0.127	A1ZAV3.pdb.gz	A1ZAV3_DROME Misexpression suppressor of ras 4, isoform A OS=Drosophila melanogaster OX=7227 GN=MESR4 PE=1 SV=1
10	AFDB:P48415	0.038	0.035	7.330E-5	2195	0.149	0.126	P48415.pdb.gz	SEC16_YEAST COPII coat assembly protein SEC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC16 PE=1 SV=2
11	PDB:5it0A	0.050	0.163	3.591E-4	396	0.023	0.109	5it0A.pdb.gz	SAD phasing using iodide ions in a high-throughput structural genomics environment.
12	PDB:3vcdA	0.044	0.241	9.367E-4	184	0.018	0.185	3vcdA.pdb.gz
13	PDB:7r5jH0	0.056	0.216	9.367E-4	383	0.018	0.086	7r5jH0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
14	PDB:2v9kA	0.044	0.123	2.182E-3	467	0.014	0.056	2v9kA.pdb.gz	Crystal Structure of Human Pus10, a Novel Pseudouridine Synthase.
15	PDB:6ofsA	0.049	0.083	7.133E-3	905	0.012	0.024	6ofsA.pdb.gz	Protease-associated import systems are widespread in Gram-negative bacteria.
16	PDB:7uliAAA	0.056	0.215	1.000E-2	377	0.018	0.088	7uliAAA.pdb.gz
17	PDB:1q2lA	0.044	0.074	1.058E-2	937	0.027	0.052	1q2lA.pdb.gz	Crystal Structure of pitrilysin, the prototype of insulin-degrading enzymes
18	PDB:1q8kA	0.038	0.178	1.058E-2	300	0.007	0.043	1q8kA.pdb.gz
19	PDB:6bm7E	0.045	0.162	1.254E-2	291	0.019	0.124	6bm7E.pdb.gz	Species-Selective Pyrimidineamine Inhibitors of Trypanosoma brucei S-Adenosylmethionine Decarboxylase.
20	PDB:5xteK	0.041	0.105	1.571E-2	419	0.016	0.069	5xteK.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68FD9	1.19e-88	324	1940	0.162	0.154	K1549_MOUSE UPF0606 protein KIAA1549 OS=Mus musculus OX=10090 GN=Kiaa1549 PE=1 SV=3
2	Q9HCM3	4.39e-86	316	1950	0.183	0.173	K1549_HUMAN UPF0606 protein KIAA1549 OS=Homo sapiens OX=9606 GN=KIAA1549 PE=1 SV=4
3	M9PCJ6	1.27e-04	49.7	18641	0.030	0.003	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
4	M9PC48	1.29e-04	49.7	18095	0.030	0.003	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
5	Q9VAE4	0.052	40.8	1007	0.011	0.020	Q9VAE4_DROME RE09305p OS=Drosophila melanogaster OX=7227 GN=CG15516 PE=2 SV=2
6	B7Z0R9	0.053	40.8	1006	0.011	0.020	B7Z0R9_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG15518 PE=4 SV=2
7	A0A0R4INF0	0.21	39.3	1570	0.014	0.017	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
8	O18977	0.51	37.7	4135	0.026	0.012	O18977_BOVIN Tenascin-X OS=Bos taurus OX=9913 GN=TN-X PE=2 SV=1
9	G5EFR6	0.69	37.4	1252	0.012	0.018	MCA1_CAEEL Plasma membrane calcium-transporting ATPase mca-1 OS=Caenorhabditis elegans OX=6239 GN=mca-1 PE=1 SV=1
10	P22105	0.73	37.4	4244	0.020	0.009	TENX_HUMAN Tenascin-X OS=Homo sapiens OX=9606 GN=TNXB PE=1 SV=5
11	E9QYP0	3.1	35.0	501	0.023	0.084	SIDA_ASPFU L-ornithine N(5)-monooxygenase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=sidA PE=1 SV=1
12	B7YZU2	3.5	35.0	1693	0.007	0.008	LINT_DROME Serine protease filzig OS=Drosophila melanogaster OX=7227 GN=flz PE=2 SV=1
13	Q54YZ0	6.7	33.9	502	0.021	0.076	UGPA2_DICDI UTP--glucose-1-phosphate uridylyltransferase 2 OS=Dictyostelium discoideum OX=44689 GN=ugpB PE=2 SV=1
14	A5A8W4	7.9	33.9	4137	0.023	0.010	A5A8W4_PIG Tenascin XB OS=Sus scrofa OX=9823 GN=TNXB PE=3 SV=1
15	Q95SY7	8.8	32.3	155	0.012	0.148	Q95SY7_DROME LD39266p OS=Drosophila melanogaster OX=7227 GN=Sar1 PE=2 SV=1
16	Q9VD29	9.3	32.7	193	0.012	0.119	Q9VD29_DROME RE74312p OS=Drosophila melanogaster OX=7227 GN=Sar1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12877 DUF3827	3.1e-274	923.2	Domain of unknown function (DUF3827)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315295

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315791	0.907	Cleavage stimulation factor subunit 3
2	9606.ENSP00000241051	0.820	DEP domain containing 7
3	9606.ENSP00000265651	0.816	F-box only protein 3
4	9606.ENSP00000359042	0.718	Pre-mRNA-splicing factor 38B
5	9606.ENSP00000380880	0.680	PQ-loop repeat-containing protein 1
6	9606.ENSP00000379191	0.640	CD59 glycoprotein
7	9606.ENSP00000362444	0.637	Disks large-associated protein 3
8	9606.ENSP00000419249	0.633	RIIa domain-containing protein 1
9	9606.ENSP00000358363	0.614	Myomegalin
10	9606.ENSP00000216442	0.612	V-type proton ATPase subunit D
11	9606.ENSP00000296411	0.605	Methionine aminopeptidase 1
12	9606.ENSP00000477352	0.584	Short coiled-coil protein
13	9606.ENSP00000272847	0.582	Parathyroid hormone 2 receptor
14	9606.ENSP00000304226	0.566	Homeodomain-interacting protein kinase 3
15	9606.ENSP00000417548	0.556	DnaJ homolog subfamily C member 24
16	9606.ENSP00000362993	0.545	Protein bicaudal C homolog 1
17	9606.ENSP00000379451	0.504	Zinc finger protein 418
18	9606.ENSP00000217109	0.501	Cleavage stimulation factor subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.508	organic cyclic compound binding
GO:1901363	0.507	heterocyclic compound binding
GO:0003824	0.483	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0009987	0.978	cellular process
GO:0050794	0.955	regulation of cellular process
GO:0032501	0.829	multicellular organismal process
GO:0050896	0.384	response to stimulus
GO:0032502	0.301	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.976	membrane
GO:0043231	0.976	intracellular membrane-bounded organelle
GO:0071944	0.968	cell periphery
GO:0005737	0.962	cytoplasm
GO:0005886	0.946	plasma membrane
GO:0005634	0.806	nucleus
GO:0031974	0.776	membrane-enclosed lumen
GO:0043233	0.608	organelle lumen
GO:0070013	0.604	intracellular organelle lumen
GO:0012505	0.548	endomembrane system
GO:0031981	0.380	nuclear lumen
GO:0005654	0.342	nucleoplasm
GO:0005794	0.301	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]