StarFunc result for job id Q6ZVN7

User Input

>input (128 residues)
MYCQDSNICAVFAVQGGKVGRKHGIKRGRRPSIRSPAQRARGPWIHESKHPAFAKQQINL
EMPNSRATTELAWVCSSTSRKKKWARSLTLSTAPLSPPPSLVHCEDCSCLPGCHSGDLYN
LAPAERTC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95279	0.157	0.058	2.344	499	0.117	0.030	O95279.pdb.gz	KCNK5_HUMAN Potassium channel subfamily K member 5 OS=Homo sapiens OX=9606 GN=KCNK5 PE=1 SV=1
2	AFDB:O43309	0.123	0.038	3.701	604	0.133	0.028	O43309.pdb.gz	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
3	AFDB:Q0WTS1	0.167	0.082	6.307	315	0.195	0.079	Q0WTS1.pdb.gz	Q0WTS1_ARATH Copper ion binding protein OS=Arabidopsis thaliana OX=3702 GN=At4g32610 PE=1 SV=1
4	AFDB:O00559	0.152	0.099	6.806	213	0.156	0.094	O00559.pdb.gz	RCAS1_HUMAN Receptor-binding cancer antigen expressed on SiSo cells OS=Homo sapiens OX=9606 GN=EBAG9 PE=1 SV=1
5	AFDB:P53865	0.113	0.037	7.344	581	0.133	0.029	P53865.pdb.gz	CNM67_YEAST Chaotic nuclear migration protein 67 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CNM67 PE=1 SV=1
6	AFDB:Q9LU05	0.202	0.163	7.344	168	0.109	0.083	Q9LU05.pdb.gz	PCAP2_ARATH Plasma membrane-associated cation-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=PCAP2 PE=1 SV=1
7	AFDB:A0A494B8Y7	0.106	0.096	8.552	176	0.164	0.119	A0A494B8Y7.pdb.gz	A0A494B8Y7_MOUSE AHNAK nucleoprotein (desmoyokin) OS=Mus musculus OX=10090 GN=Ahnak PE=1 SV=1
8	AFDB:Q9SL96	0.133	0.065	9.229	318	0.148	0.060	Q9SL96.pdb.gz	Q9SL96_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g25670 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9J1E1	2.7	28.9	102	0.094	0.118	C9J1E1_HUMAN Biliverdin reductase A (Fragment) OS=Homo sapiens OX=9606 GN=BLVRA PE=1 SV=1
2	Q91562	3.5	29.6	1427	0.148	0.013	Q91562_XENLA Deleted in colorectal carcinoma OS=Xenopus laevis OX=8355 GN=dcc.L PE=1 SV=1
3	J9VT33	4.4	29.3	1048	0.094	0.011	CUF1_CRYNH Copper-dependent transcription factor 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CUF1 PE=1 SV=1
4	Q83SQ0	8.0	28.5	784	0.133	0.022	LPTD_SHIFL LPS-assembly protein LptD OS=Shigella flexneri OX=623 GN=lptD PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17697 DUF5543	2.4e-75	261.8	Family of unknown function (DUF5543)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000000041

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000026731	0.960	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 3
2	9593.ENSGGOP00000015446	0.959	BRCA2, DNA repair associated
3	9593.ENSGGOP00000015361	0.941	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
4	9593.ENSGGOP00000000404	0.933	Uncharacterized protein
5	9593.ENSGGOP00000003987	0.929	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
6	9593.ENSGGOP00000017718	0.903	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6
7	9593.ENSGGOP00000026776	0.852	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 11
8	9593.ENSGGOP00000022092	0.806	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 13
9	9593.ENSGGOP00000014402	0.742	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
10	9593.ENSGGOP00000023157	0.725	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 2
11	9593.ENSGGOP00000013922	0.716	RAD51 recombinase
12	9593.ENSGGOP00000004373	0.712	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
13	9593.ENSGGOP00000019988	0.712	Uncharacterized protein
14	9593.ENSGGOP00000008962	0.710	Proteasome (prosome, macropain) 26S subunit, ATPase, 2
15	9593.ENSGGOP00000010359	0.710	Proteasome (prosome, macropain) 26S subunit, ATPase, 1
16	9593.ENSGGOP00000015346	0.710	Minichromosome maintenance complex component 3 associated protein
17	9593.ENSGGOP00000019901	0.708	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
18	9593.ENSGGOP00000008265	0.703	Adhesion regulating molecule 1
19	9593.ENSGGOP00000005218	0.698	Suv3 like RNA helicase
20	9593.ENSGGOP00000009375	0.696	Centrin, EF-hand protein, 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.935	regulation of biological process
GO:0050794	0.915	regulation of cellular process
GO:0031323	0.909	regulation of cellular metabolic process
GO:0071704	0.903	organic substance metabolic process
GO:0048519	0.875	negative regulation of biological process
GO:0043170	0.862	macromolecule metabolic process
GO:0048523	0.861	negative regulation of cellular process
GO:0009987	0.840	cellular process
GO:0044238	0.599	primary metabolic process
GO:0006807	0.585	nitrogen compound metabolic process
GO:0060255	0.563	regulation of macromolecule metabolic process
GO:0019219	0.558	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.539	regulation of RNA metabolic process
GO:0010468	0.523	regulation of gene expression
GO:1903506	0.484	regulation of nucleic acid-templated transcription
GO:0006355	0.474	regulation of DNA-templated transcription
GO:0044237	0.418	cellular metabolic process
GO:0050896	0.407	response to stimulus
GO:0048583	0.404	regulation of response to stimulus
GO:0032501	0.353	multicellular organismal process
GO:0048585	0.352	negative regulation of response to stimulus
GO:0031324	0.351	negative regulation of cellular metabolic process
GO:0019538	0.345	protein metabolic process
GO:0032502	0.343	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0070013	0.936	intracellular organelle lumen
GO:0031981	0.933	nuclear lumen
GO:0005654	0.840	nucleoplasm
GO:0005829	0.628	cytosol
GO:0032991	0.506	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]