StarFunc result for job id Q6ZVN8

User Input

>input (426 residues)
MGEPGQSPSPRSSHGSPPTLSTLTLLLLLCGHAHSQCKILRCNAEYVSSTLSLRGGGSSG
ALRGGGGGGRGGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCS
RQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHH
HFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEV
DNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKV
AEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHS
CVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSDAGVPLSSATLLAPLLSGLFV
LWLCIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZVN8	1.000	1.000	5.776E-80	426	1.000	1.000	Q6ZVN8.pdb.gz	RGMC_HUMAN Hemojuvelin OS=Homo sapiens OX=9606 GN=HJV PE=1 SV=1
2	AFDB:Q8N7M5	0.633	0.639	2.464E-68	422	0.864	0.872	Q8N7M5.pdb.gz	RGMC_RAT Hemojuvelin OS=Rattus norvegicus OX=10116 GN=Hjv PE=2 SV=1
3	AFDB:Q6PCX7	0.577	0.543	6.179E-46	454	0.486	0.456	Q6PCX7.pdb.gz	RGMA_MOUSE Repulsive guidance molecule A OS=Mus musculus OX=10090 GN=Rgma PE=1 SV=1
4	AFDB:B3DGM8	0.573	0.594	2.487E-45	410	0.441	0.459	B3DGM8.pdb.gz
5	AFDB:Q8JG54	0.583	0.575	5.860E-45	432	0.458	0.451	Q8JG54.pdb.gz	RGMA_CHICK Repulsive guidance molecule A OS=Gallus gallus OX=9031 GN=RGMA PE=1 SV=1
6	AFDB:Q6NW40	0.585	0.571	2.770E-44	437	0.432	0.421	Q6NW40.pdb.gz	RGMB_HUMAN Repulsive guidance molecule B OS=Homo sapiens OX=9606 GN=RGMB PE=1 SV=3
7	AFDB:Q1LVM8	0.577	0.548	5.267E-44	449	0.446	0.423	Q1LVM8.pdb.gz	Q1LVM8_DANRE Repulsive guidance molecule A OS=Danio rerio OX=7955 GN=dlm PE=1 SV=1
8	AFDB:Q7TQ33	0.584	0.571	6.525E-44	436	0.434	0.424	Q7TQ33.pdb.gz	RGMB_MOUSE Repulsive guidance molecule B OS=Mus musculus OX=10090 GN=Rgmb PE=1 SV=1
9	AFDB:A0A0B5JF96	0.564	0.585	7.665E-43	410	0.437	0.454	A0A0B5JF96.pdb.gz
10	AFDB:G5EDE5	0.573	0.596	6.233E-25	408	0.209	0.218	G5EDE5.pdb.gz	RGMB_CAEEL Repulsive guidance molecule B homolog drag-1 OS=Caenorhabditis elegans OX=6239 GN=drag-1 PE=1 SV=1
11	PDB:6z3mc	0.365	0.973	8.383E-21	158	0.197	0.532	6z3mc.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
12	PDB:6z3mP	0.165	0.894	3.985E-6	76	0.094	0.526	6z3mP.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
13	PDB:2qosC	0.095	0.178	6.816E-3	173	0.054	0.133	2qosC.pdb.gz	Crystal structure of complement protein C8gamma in complex with a peptide containing the C8gamma binding site on C8alpha: Implications for C8gamma ligand binding.
14	PDB:3saoA	0.095	0.211	9.917E-3	150	0.031	0.087	3saoA.pdb.gz	Galline Ex-FABP Is an Antibacterial Siderocalin and a Lysophosphatidic Acid Sensor Functioning through Dual Ligand Specificities.
15	PDB:2qo5A	0.105	0.229	2.600E-2	129	0.031	0.101	2qo5A.pdb.gz
16	PDB:5n47A	0.090	0.163	3.054E-2	180	0.038	0.089	5n47A.pdb.gz
17	PDB:3cm1A	0.079	0.171	5.504E-2	137	0.026	0.080	3cm1A.pdb.gz
18	PDB:4gh7A	0.085	0.152	5.504E-2	174	0.033	0.080	4gh7A.pdb.gz
19	PDB:6suaA	0.090	0.168	5.504E-2	174	0.045	0.109	6suaA.pdb.gz
20	PDB:2bonA	0.088	0.112	6.819E-2	287	0.045	0.066	2bonA.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZVN8	0.0	865	426	1.000	1.000	RGMC_HUMAN Hemojuvelin OS=Homo sapiens OX=9606 GN=HJV PE=1 SV=1
2	Q7TQ32	0.0	690	420	0.864	0.876	RGMC_MOUSE Hemojuvelin OS=Mus musculus OX=10090 GN=Hjv PE=1 SV=1
3	Q8N7M5	0.0	687	422	0.864	0.872	RGMC_RAT Hemojuvelin OS=Rattus norvegicus OX=10116 GN=Hjv PE=2 SV=1
4	Q6PCX7	1.19e-125	373	454	0.477	0.447	RGMA_MOUSE Repulsive guidance molecule A OS=Mus musculus OX=10090 GN=Rgma PE=1 SV=1
5	D4A188	1.30e-125	373	449	0.484	0.459	D4A188_RAT Repulsive guidance molecule BMP co-receptor a OS=Rattus norvegicus OX=10116 GN=Rgma PE=3 SV=1
6	A0A8I6ACJ0	2.57e-124	369	454	0.472	0.443	A0A8I6ACJ0_RAT Repulsive guidance molecule BMP co-receptor a OS=Rattus norvegicus OX=10116 GN=Rgma PE=3 SV=1
7	Q96B86	4.94e-123	366	450	0.477	0.451	RGMA_HUMAN Repulsive guidance molecule A OS=Homo sapiens OX=9606 GN=RGMA PE=1 SV=4
8	Q1JQE7	4.34e-120	357	410	0.446	0.463	Q1JQE7_DANRE Hemochromatosis type 2 OS=Danio rerio OX=7955 GN=hfe2 PE=1 SV=1
9	Q8JG54	1.83e-119	356	432	0.434	0.428	RGMA_CHICK Repulsive guidance molecule A OS=Gallus gallus OX=9031 GN=RGMA PE=1 SV=1
10	Q1LVM8	1.81e-116	349	449	0.451	0.428	Q1LVM8_DANRE Repulsive guidance molecule A OS=Danio rerio OX=7955 GN=dlm PE=1 SV=1
11	Q6NW40	7.11e-108	327	437	0.420	0.410	RGMB_HUMAN Repulsive guidance molecule B OS=Homo sapiens OX=9606 GN=RGMB PE=1 SV=3
12	Q7TQ33	3.73e-107	325	436	0.404	0.394	RGMB_MOUSE Repulsive guidance molecule B OS=Mus musculus OX=10090 GN=Rgmb PE=1 SV=1
13	G5EDE5	1.93e-17	85.9	408	0.202	0.211	RGMB_CAEEL Repulsive guidance molecule B homolog drag-1 OS=Caenorhabditis elegans OX=6239 GN=drag-1 PE=1 SV=1
14	Q6FLW1	2.6	33.1	1075	0.042	0.017	Q6FLW1_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K13024g PE=4 SV=1
15	Q38A31	3.4	32.3	491	0.033	0.029	Q38A31_TRYB2 NADH dehydrogenase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0960 PE=3 SV=1
16	Q588V7	5.5	32.0	2154	0.038	0.007	TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana OX=3702 GN=TEB PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06534 RGM_C	7.2e-55	196.6	Repulsive guidance molecule (RGM) C-terminus
2	PF06535 RGM_N	8.8e-58	206.7	Repulsive guidance molecule (RGM) N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337014

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341198	0.999	Neogenin
2	9606.ENSP00000368104	0.999	Bone morphogenetic protein 2
3	9606.ENSP00000420525	0.997	Transferrin receptor protein 2
4	9606.ENSP00000417404	0.996	Hereditary hemochromatosis protein
5	9606.ENSP00000283147	0.989	Bone morphogenetic protein 6
6	9606.ENSP00000361107	0.986	Bone morphogenetic protein receptor type-1A
7	9606.ENSP00000371211	0.981	Transmembrane protease serine 6
8	9606.ENSP00000363708	0.960	Bone morphogenetic protein receptor type-2
9	9606.ENSP00000401907	0.949	Bone morphogenetic protein receptor type-1B
10	9606.ENSP00000245451	0.946	Bone morphogenetic protein 4
11	9606.ENSP00000263640	0.942	Activin receptor type-1
12	9606.ENSP00000441954	0.942	Mothers against decapentaplegic homolog 5
13	9606.ENSP00000262158	0.934	Mothers against decapentaplegic homolog 7
14	9606.ENSP00000353224	0.933	Transferrin receptor protein 1
15	9606.ENSP00000369154	0.930	Mothers against decapentaplegic homolog 9
16	9606.ENSP00000426568	0.927	Mothers against decapentaplegic homolog 1
17	9606.ENSP00000304930	0.922	Sclerostin domain-containing protein 1
18	9606.ENSP00000364683	0.918	BMP and activin membrane-bound inhibitor homolog
19	9606.ENSP00000328181	0.917	Noggin
20	9606.ENSP00000471894	0.917	Hepcidin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015026	1.000	coreceptor activity
GO:0036122	1.000	BMP binding
GO:0005102	0.993	signaling receptor binding
GO:0003824	0.992	catalytic activity
GO:0140096	0.982	catalytic activity, acting on a protein
GO:0016773	0.929	phosphotransferase activity, alcohol group as acceptor
GO:0016301	0.892	kinase activity
GO:0004675	0.857	transmembrane receptor protein serine/threonine kinase activity
GO:1990459	0.440	transferrin receptor binding
GO:0098821	0.344	BMP receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.985	response to stimulus
GO:0019222	0.973	regulation of metabolic process
GO:0080090	0.964	regulation of primary metabolic process
GO:0051171	0.964	regulation of nitrogen compound metabolic process
GO:0031323	0.964	regulation of cellular metabolic process
GO:0060255	0.961	regulation of macromolecule metabolic process
GO:0048522	0.939	positive regulation of cellular process
GO:0055072	0.922	iron ion homeostasis
GO:0019538	0.916	protein metabolic process
GO:0010468	0.893	regulation of gene expression
GO:0031325	0.886	positive regulation of cellular metabolic process
GO:0009889	0.881	regulation of biosynthetic process
GO:0051173	0.868	positive regulation of nitrogen compound metabolic process
GO:0019219	0.863	regulation of nucleobase-containing compound metabolic process
GO:0051716	0.851	cellular response to stimulus
GO:0010604	0.850	positive regulation of macromolecule metabolic process
GO:0031326	0.824	regulation of cellular biosynthetic process
GO:0010556	0.823	regulation of macromolecule biosynthetic process
GO:0007167	0.808	enzyme-linked receptor protein signaling pathway
GO:0006355	0.794	regulation of DNA-templated transcription
GO:0030509	0.787	BMP signaling pathway
GO:0006357	0.770	regulation of transcription by RNA polymerase II
GO:0048519	0.754	negative regulation of biological process
GO:0031328	0.725	positive regulation of cellular biosynthetic process
GO:0045935	0.708	positive regulation of nucleobase-containing compound metabolic process
GO:0048523	0.705	negative regulation of cellular process
GO:0045944	0.701	positive regulation of transcription by RNA polymerase II
GO:0048583	0.637	regulation of response to stimulus
GO:0010467	0.636	gene expression
GO:0023051	0.595	regulation of signaling
GO:0010646	0.581	regulation of cell communication
GO:0032502	0.545	developmental process
GO:0090092	0.512	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048856	0.508	anatomical structure development
GO:0044237	0.431	cellular metabolic process
GO:0009892	0.405	negative regulation of metabolic process
GO:0032501	0.341	multicellular organismal process
GO:0006508	0.301	proteolysis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.995	plasma membrane
GO:0005576	0.986	extracellular region
GO:0032991	0.974	protein-containing complex
GO:0005615	0.952	extracellular space
GO:0043231	0.838	intracellular membrane-bounded organelle
GO:0005737	0.790	cytoplasm
GO:0043235	0.511	receptor complex
GO:0098797	0.442	plasma membrane protein complex
GO:0098802	0.429	plasma membrane signaling receptor complex
GO:0009986	0.340	cell surface
GO:0045178	0.314	basal part of cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.929	Phosphotransferases with an alcohol group as acceptor.
RHEA:18673	0.857	ATP + L-seryl-[receptor-protein] = ADP + H(+) + O-phospho-L-seryl-[receptor-protein]
EC:2.7.11.30	0.857	receptor protein serine/threonine kinase.

[back to server]