StarFunc result for job id Q6ZW49

User Input

>input (1069 residues)
MSDQAPKVPEEMFREVKYYAVGDIDPQVIQLLKAGKAKEVSYNALASHIISEDGDNPEVG
EAREVFDLPVVKPSWVILSVQCGTLLPVNGFSPESCQIFFGITACLSQVSSEDRSALWAL
VTFYGGDCQLTLNKKCTHLIVPEPKGEKYECALKRASIKIVTPDWVLDCVSEKTKKDEAF
YHPRLIIYEEEEEEEEEEEEVENEEQDSQNEGSTDEKSSPASSQEGSPSGDQQFSPKSNT
EKSKGELMFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVPPVP
GNILPPEVRGNLMAAGQNLQSSERSEMIATWSPAVRTLRNITNNADIQQMNRPSNVAHIL
QTLSAPTKNLEQQVNHSQQGHTNANAVLFSQVKVTPETHMLQQQQQAQQQQQQHPVLHLQ
PQQIMQLQQQQQQQISQQPYPQQPPHPFSQQQQQQQQAHPHQFSQQQLQFPQQQLHPPQQ
LHRPQQQLQPFQQQHALQQQFHQLQQHQLQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRM
HQQQQQQQMQSQTAPHLSQTSQALQHQVPPQQPPQQQQQQQPPPSPQQHQLFGHDPAVEI
PEEGFLLGCVFAIADYPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCESQVSSA
YAQAIRERKRCVTAHWLNTVLKKKKMVPPHRALHFPVAFPPGGKPCSQHIISVTGFVDSD
RDDLKLMAYLAGAKYTGYLCRSNTVLICKEPTGLKYEKAKEWRIPCVNAQWLGDILLGNF
EALRQIQYSRYTAFSLQDPFAPTQHLVLNLLDAWRVPLKVSAELLMSIRLPPKLKQNEVA
NVQPSSKRARIEDVPPPTKKLTPELTPFVLFTGFEPVQVQQYIKKLYILGGEVAESAQKC
THLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSFSL
EESLKRAHVSPLFKAKYFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSS
LSEIILISCENDLHLCREYFARGIDVHNAEFVLTGVLTQTLDYESYKFN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NZQ4	0.666	0.674	0.000	1056	0.851	0.862	Q6NZQ4.pdb.gz	PAXI1_MOUSE PAX-interacting protein 1 OS=Mus musculus OX=10090 GN=Paxip1 PE=1 SV=1
2	AFDB:Q6ZW49	1.000	1.000	0.000	1069	1.000	1.000	Q6ZW49.pdb.gz	PAXI1_HUMAN PAX-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAXIP1 PE=1 SV=2
3	AFDB:Q14676	0.175	0.091	3.938E-17	2089	0.156	0.080	Q14676.pdb.gz	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
4	AFDB:O96685	0.166	0.141	4.478E-7	1261	0.094	0.080	O96685.pdb.gz	O96685_DROME Mutator 2 OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
5	AFDB:P48754	0.159	0.096	5.406E-6	1812	0.118	0.070	P48754.pdb.gz	BRCA1_MOUSE Breast cancer type 1 susceptibility protein homolog OS=Mus musculus OX=10090 GN=Brca1 PE=1 SV=3
6	PDB:7lsyY	0.071	0.087	2.993E-5	855	0.034	0.042	7lsyY.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
7	AFDB:Q12114	0.074	0.116	1.150E-4	671	0.066	0.106	Q12114.pdb.gz	CHS5_YEAST Chitin biosynthesis protein CHS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHS5 PE=1 SV=1
8	PDB:7ohpn	0.077	0.231	1.209E-2	314	0.020	0.067	7ohpn.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
9	AFDB:Q54YH4	0.058	0.035	2.101E-2	1969	0.106	0.057	Q54YH4.pdb.gz	DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum OX=44689 GN=dhkB PE=1 SV=1
10	PDB:7p5zG	0.070	0.296	2.825E-2	213	0.012	0.061	7p5zG.pdb.gz	Structural mechanism for the selective phosphorylation of DNA-loaded MCM double hexamers by the Dbf4-dependent kinase.
11	PDB:7nacn	0.075	0.180	3.348E-2	425	0.021	0.052	7nacn.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
12	PDB:4cjxA	0.066	0.172	6.990E-2	297	0.017	0.061	4cjxA.pdb.gz	Characterization of 2,4-Diamino-6-Oxo-1,6-Dihydropyrimidin-5-Yl Ureido Based Inhibitors of Trypanosoma Brucei Fold and Testing for Antiparasitic Activity.
13	AFDB:Q550K3	0.049	0.038	8.652E-2	1462	0.102	0.075	Q550K3.pdb.gz	Q550K3_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277075 PE=4 SV=1
14	AFDB:Q9GYQ9	0.037	0.047	1.085E-1	796	0.092	0.123	Q9GYQ9.pdb.gz	Q9GYQ9_CAEEL CCR4-NOT transcription complex subunit 4 OS=Caenorhabditis elegans OX=6239 GN=ntl-4 PE=1 SV=2
15	PDB:7v3vI	0.064	0.193	1.099E-1	328	0.012	0.040	7v3vI.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
16	AFDB:P35187	0.070	0.058	2.685E-1	1447	0.086	0.064	P35187.pdb.gz	SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGS1 PE=1 SV=1
17	PDB:8dr5A	0.056	0.091	3.046E-1	646	0.013	0.022	8dr5A.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
18	PDB:4cvhA	0.051	0.120	4.042E-1	391	0.017	0.046	4cvhA.pdb.gz	Human Ispd is a Cytidyltransferase Required for Dystroglycan O-Mannosylation.
19	PDB:5z1zC	0.049	0.123	4.042E-1	316	0.023	0.079	5z1zC.pdb.gz
20	PDB:7pt6I	0.063	0.179	4.042E-1	341	0.008	0.026	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NZQ4	0.0	956	1056	0.434	0.439	PAXI1_MOUSE PAX-interacting protein 1 OS=Mus musculus OX=10090 GN=Paxip1 PE=1 SV=1
2	Q6ZW49	0.0	2190	1069	1.000	1.000	PAXI1_HUMAN PAX-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAXIP1 PE=1 SV=2
3	Q9VUB7	1.42e-76	279	2294	0.152	0.071	Q9VUB7_DROME PAX transcription activation domain interacting protein OS=Drosophila melanogaster OX=7227 GN=Ptip PE=1 SV=3
4	Q9U370	1.76e-32	139	1076	0.121	0.120	Q9U370_CAEEL BRCT domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pis-1 PE=1 SV=1
5	Q5PSV9	7.26e-26	118	1707	0.065	0.040	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
6	A0A1U9XBC1	4.57e-25	115	2089	0.060	0.031	A0A1U9XBC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 PE=4 SV=1
7	Q14676	4.57e-25	115	2089	0.060	0.031	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
8	Q10337	2.30e-17	90.1	878	0.053	0.065	BRC1_SCHPO BRCT-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brc1 PE=1 SV=1
9	Q800K6	5.08e-13	76.3	1513	0.037	0.026	TOB1A_XENLA DNA topoisomerase 2-binding protein 1-A OS=Xenopus laevis OX=8355 GN=topbp1-A PE=1 SV=2
10	A0A2R8YD63	1.07e-12	75.1	1517	0.079	0.055	A0A2R8YD63_HUMAN DNA topoisomerase II binding protein 1 OS=Homo sapiens OX=9606 GN=TOPBP1 PE=1 SV=1
11	Q92547	1.10e-11	72.0	1522	0.080	0.057	TOPB1_HUMAN DNA topoisomerase 2-binding protein 1 OS=Homo sapiens OX=9606 GN=TOPBP1 PE=1 SV=3
12	Q6ZQF0	9.69e-11	68.9	1515	0.038	0.027	TOPB1_MOUSE DNA topoisomerase 2-binding protein 1 OS=Mus musculus OX=10090 GN=Topbp1 PE=1 SV=2
13	A0A2R8RVN3	1.63e-10	68.2	1526	0.079	0.055	A0A2R8RVN3_DANRE DNA topoisomerase 2-binding protein 1 OS=Danio rerio OX=7955 GN=topbp1 PE=1 SV=1
14	F1R135	1.64e-10	68.2	1520	0.079	0.055	F1R135_DANRE DNA topoisomerase 2-binding protein 1 isoform X1 OS=Danio rerio OX=7955 GN=topbp1 PE=1 SV=1
15	O14079	7.09e-10	65.5	624	0.041	0.071	MDB1_SCHPO DNA damage response protein Mdb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mdb1 PE=1 SV=2
16	F4I701	1.23e-08	61.6	972	0.026	0.029	F4I701_ARATH Transcription coactivator OS=Arabidopsis thaliana OX=3702 GN=MEI1 PE=1 SV=1
17	Q9W061	1.14e-06	55.5	1259	0.031	0.026	Q9W061_DROME Mutator 2, isoform B OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
18	A2VEF9	1.24e-06	55.5	1274	0.031	0.026	A2VEF9_DROME IP15561p OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
19	Q95RC8	1.28e-06	55.5	1280	0.031	0.026	Q95RC8_DROME LD44171p OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
20	Q20129	5.40e-06	53.1	1182	0.032	0.029	Q20129_CAEEL BRCT domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mus-101 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00533 BRCT	1.3e-50	181.0	BRCA1 C Terminus (BRCT) domain
2	PF16589 BRCT_2	1.5e-28	110.4	BRCT domain, a BRCA1 C-terminus domain
3	PF16759 LIG3_BRCT	4.8e-09	47.8	DNA ligase 3 BRCT domain
4	PF12738 PTCB-BRCT	1.2e-51	183.8	twin BRCT domain
5	PF16770 RTT107_BRCT_5	5.4e-25	98.5	Regulator of Ty1 transposition protein 107 BRCT domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384048

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262189	0.999	Histone-lysine N-methyltransferase 2C
2	9606.ENSP00000301067	0.999	Histone-lysine N-methyltransferase 2D
3	9606.ENSP00000367203	0.999	Lysine-specific demethylase 6A
4	9606.ENSP00000371475	0.999	TP53-binding protein 1
5	9606.ENSP00000264515	0.998	Retinoblastoma-binding protein 5
6	9606.ENSP00000340896	0.998	Set1/Ash2 histone methyltransferase complex subunit ASH2
7	9606.ENSP00000351446	0.998	WD repeat-containing protein 5
8	9606.ENSP00000363929	0.997	Nuclear receptor coactivator 6
9	9606.ENSP00000326519	0.995	PAXIP1 associated glutamate rich protein 1
10	9606.ENSP00000359319	0.992	Paired box protein Pax-2
11	9606.ENSP00000476774	0.988	PAXIP1-associated glutamate-rich protein 1
12	9606.ENSP00000345837	0.986	Protein dpy-30 homolog
13	9606.ENSP00000398837	0.983	Histone-lysine N-methyltransferase 2B
14	9606.ENSP00000404092	0.981	Structural maintenance of chromosomes protein 6
15	9606.ENSP00000347232	0.973	Bloom syndrome protein
16	9606.ENSP00000320147	0.943	Histone-lysine N-methyltransferase EZH2
17	9606.ENSP00000434024	0.941	Histone H2AX
18	9606.ENSP00000350844	0.936	Paired box protein Pax-5
19	9606.ENSP00000278616	0.930	Serine-protein kinase ATM
20	9606.ENSP00000316578	0.930	Polycomb protein SUZ12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.994	nitrogen compound metabolic process
GO:0050896	0.990	response to stimulus
GO:0044260	0.989	cellular macromolecule metabolic process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0080090	0.982	regulation of primary metabolic process
GO:0051171	0.979	regulation of nitrogen compound metabolic process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0048518	0.977	positive regulation of biological process
GO:0006974	0.974	cellular response to DNA damage stimulus
GO:0036211	0.967	protein modification process
GO:0048522	0.966	positive regulation of cellular process
GO:0051173	0.956	positive regulation of nitrogen compound metabolic process
GO:0010604	0.956	positive regulation of macromolecule metabolic process
GO:0009889	0.955	regulation of biosynthetic process
GO:0045935	0.949	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.946	regulation of DNA-templated transcription
GO:0045944	0.941	positive regulation of transcription by RNA polymerase II
GO:0007154	0.879	cell communication
GO:0035556	0.839	intracellular signal transduction
GO:2000142	0.822	regulation of DNA-templated transcription initiation
GO:0008213	0.804	protein alkylation
GO:0009628	0.802	response to abiotic stimulus
GO:0072331	0.789	signal transduction by p53 class mediator
GO:0018205	0.777	peptidyl-lysine modification
GO:0009314	0.773	response to radiation
GO:0010212	0.732	response to ionizing radiation
GO:0016570	0.725	histone modification
GO:2000144	0.722	positive regulation of DNA-templated transcription initiation
GO:0042770	0.683	signal transduction in response to DNA damage
GO:0065009	0.622	regulation of molecular function
GO:0043414	0.595	macromolecule methylation
GO:0018022	0.592	peptidyl-lysine methylation
GO:0034641	0.560	cellular nitrogen compound metabolic process
GO:0060260	0.551	regulation of transcription initiation by RNA polymerase II
GO:0006139	0.537	nucleobase-containing compound metabolic process
GO:0090304	0.530	nucleic acid metabolic process
GO:0016571	0.461	histone methylation
GO:0051568	0.410	histone H3-K4 methylation
GO:0030330	0.401	DNA damage response, signal transduction by p53 class mediator
GO:0051052	0.396	regulation of DNA metabolic process
GO:0048519	0.392	negative regulation of biological process
GO:0048523	0.374	negative regulation of cellular process
GO:0060261	0.365	positive regulation of transcription initiation by RNA polymerase II
GO:0006259	0.333	DNA metabolic process
GO:0048583	0.321	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0035097	1.000	histone methyltransferase complex
GO:0043232	0.871	intracellular non-membrane-bounded organelle
GO:0044666	0.698	MLL3/4 complex
GO:0005737	0.327	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]