StarFunc result for job id Q6ZWH5

User Input

>input (1172 residues)
MPDQDKKVKTTEKSTDKQQEITIRDYSDLKRLRCLLNVQSSKQQLPAINFDSAQNSMTKS
EPAIRAGGHRARGQWHESTEAVELENFSINYKNERNFSKHPQRKLFQEIFTALVKNRLIS
REWVNRAPSIHFLRVLICLRLLMRDPCYQEILHSLGGIENLAQYMEIVANEYLGYGEEQH
TVDKLVNMTYIFQKLAAVKDQREWVTTSGAHKTLVNLLGARDTNVLLGSLLALASLAESQ
ECREKISELNIVENLLMILHEYDLLSKRLTAELLRLLCAEPQVKEQVKLYEGIPVLLSLL
HSDHLKLLWSIVWILVQVCEDPETSVEIRIWGGIKQLLHILQGDRNFVSDHSSIGSLSSA
NAAGRIQQLHLSEDLSPREIQENTFSLQAACCAALTELVLNDTNAHQVVQENGVYTIAKL
ILPNKQKNAAKSNLLQCYAFRALRFLFSMERNRPLFKRLFPTDLFEIFIDIGHYVRDISA
YEELVSKLNLLVEDELKQIAENIESINQNKAPLKYIGNYAILDHLGSGAFGCVYKVRKHS
GQNLLAMKEVNLHNPAFGKDKKDRDSSVRNIVSELTIIKEQLYHPNIVRYYKTFLENDRL
YIVMELIEGAPLGEHFSSLKEKHHHFTEERLWKIFIQLCLALRYLHKEKRIVHRDLTPNN
IMLGDKDKVTVTDFGLAKQKQENSKLTSVVGTILYSCPEVLKSEPYGEKADVWAVGCILY
QMATLSPPFYSTNMLSLATKIVEAVYEPVPEGIYSEKVTDTISRCLTPDAEARPDIVEVS
SMISDVMMKYLDNLSTSQLSLEKKLERERRRTQRYFMEANRNTVTCHHELAVLSHETFEK
ASLSSSSSGAASLKSELSESADLPPEGFQASYGKDEDRACDEILSDDNFNLENAEKDTYS
EVDDELDISDNSSSSSSSPLKESTFNILKRSFSASGGERQSQTRDFTGGTGSRPRPALLP
LDLLLKVPPHMLRAHIKEIEAELVTGWQSHSLPAVILRNLKDHGPQMGTFLWQASAGIAV
SQRKVRQISDPIQQILIQLHKIIYITQLPPALHHNLKRRVIERFKKSLFSQQSNPCNLKS
EIKKLSQGSPEPIEPNFFTADYHLLHRSSGGNSLSPNDPTGLPTSIELEEGITYEQMQTV
IEEVLEESGYYNFTSNRYHSYPWGTKNHPTKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZWH5	1.000	1.000	0.000	1172	1.000	1.000	Q6ZWH5.pdb.gz	NEK10_HUMAN Serine/threonine-protein kinase Nek10 OS=Homo sapiens OX=9606 GN=NEK10 PE=1 SV=3
2	PDB:6s73A	0.208	0.859	2.746E-15	269	0.077	0.335	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
3	PDB:6b1uA	0.208	0.537	1.841E-14	442	0.062	0.165	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
4	PDB:3c4wB	0.204	0.448	2.336E-14	519	0.068	0.154	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
5	PDB:5u6yA	0.204	0.505	6.548E-14	459	0.064	0.163	5u6yA.pdb.gz
6	PDB:4rewA	0.205	0.561	7.983E-14	411	0.057	0.163	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
7	PDB:7myjC	0.207	0.508	9.355E-14	465	0.061	0.153	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
8	PDB:4rerA	0.204	0.507	1.505E-13	459	0.058	0.148	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
9	PDB:6pjxA	0.207	0.435	1.630E-13	543	0.067	0.145	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
10	PDB:2yaaA	0.205	0.766	1.764E-13	300	0.063	0.247	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
11	PDB:4zhxA	0.208	0.575	2.728E-13	409	0.062	0.178	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
12	AFDB:Q9H2K8	0.210	0.271	4.975E-12	898	0.084	0.109	Q9H2K8.pdb.gz	TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens OX=9606 GN=TAOK3 PE=1 SV=2
13	AFDB:O74304	0.208	0.171	1.190E-11	1436	0.119	0.097	O74304.pdb.gz	WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=win1 PE=1 SV=1
14	AFDB:F7BN18	0.202	0.210	4.767E-11	1128	0.099	0.103	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
15	AFDB:A0A0G2K490	0.206	0.178	5.812E-11	1360	0.109	0.094	A0A0G2K490.pdb.gz	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1
16	AFDB:Q1PDW3	0.198	0.347	2.622E-10	636	0.098	0.181	Q1PDW3.pdb.gz	LIPG1_ARATH Receptor-like kinase LIP1 OS=Arabidopsis thaliana OX=3702 GN=LIP1 PE=1 SV=1
17	AFDB:Q869N2	0.201	0.274	3.186E-9	852	0.061	0.083	Q869N2.pdb.gz	PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum OX=44689 GN=pakB PE=1 SV=1
18	AFDB:Q3ULB5	0.202	0.341	3.449E-9	682	0.056	0.097	Q3ULB5.pdb.gz	PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus OX=10090 GN=Pak6 PE=2 SV=1
19	AFDB:M9PDQ2	0.212	0.244	5.127E-9	1011	0.078	0.090	M9PDQ2.pdb.gz	M9PDQ2_DROME Tousled-like kinase, isoform L OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
20	AFDB:Q5AP53	0.193	0.303	1.752E-8	732	0.075	0.120	Q5AP53.pdb.gz	CBK1_CANAL Serine/threonine-protein kinase CBK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CBK1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZWH5	0.0	2427	1172	1.000	1.000	NEK10_HUMAN Serine/threonine-protein kinase Nek10 OS=Homo sapiens OX=9606 GN=NEK10 PE=1 SV=3
2	Q9ES70	3.20e-47	174	313	0.080	0.300	NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus OX=10090 GN=Nek6 PE=1 SV=1
3	Q9HC98	2.28e-46	171	313	0.078	0.294	NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens OX=9606 GN=NEK6 PE=1 SV=2
4	Q8TDX7	3.38e-46	170	302	0.077	0.298	NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens OX=9606 GN=NEK7 PE=1 SV=1
5	Q55BN8	3.58e-46	174	418	0.081	0.227	NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum OX=44689 GN=nek2 PE=1 SV=1
6	Q9ES74	5.21e-46	170	302	0.078	0.301	NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus OX=10090 GN=Nek7 PE=1 SV=1
7	D3ZBE5	5.41e-46	170	302	0.078	0.301	NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus OX=10116 GN=Nek7 PE=1 SV=1
8	G5EFM9	2.60e-44	165	302	0.078	0.301	NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans OX=6239 GN=nekl-3 PE=1 SV=1
9	Q9W3N8	1.04e-43	173	735	0.084	0.133	Q9W3N8_DROME LD04361p OS=Drosophila melanogaster OX=7227 GN=Nek2 PE=2 SV=1
10	F6U4U2	2.96e-41	159	388	0.078	0.237	F6U4U2_HUMAN NIMA related kinase 2 OS=Homo sapiens OX=9606 GN=NEK2 PE=1 SV=1
11	O35942	4.06e-41	160	443	0.081	0.214	NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus OX=10090 GN=Nek2 PE=1 SV=2
12	P51955	5.05e-41	159	445	0.078	0.207	NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens OX=9606 GN=NEK2 PE=1 SV=1
13	Q38CJ2	1.74e-39	160	764	0.084	0.130	Q38CJ2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7860 PE=4 SV=1
14	Q7ZUN2	1.27e-38	152	440	0.088	0.234	Q7ZUN2_DANRE NIMA (Never in mitosis gene a)-related kinase 2 OS=Danio rerio OX=7955 GN=zgc:55602 PE=2 SV=1
15	Q5M813	3.26e-37	144	309	0.078	0.294	Q5M813_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=2 SV=1
16	P11837	4.80e-37	152	699	0.084	0.142	NIMA_EMENI G2-specific protein kinase nimA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nimA PE=1 SV=1
17	G5EHL3	1.65e-36	149	591	0.084	0.166	G5EHL3_MAGO7 NEK protein kinase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGCH7_ch7g813 PE=4 SV=1
18	Q69ZM6	2.41e-36	152	1316	0.078	0.069	STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus OX=10090 GN=Stk36 PE=1 SV=3
19	Q90XC2	1.07e-35	148	697	0.080	0.135	NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio OX=7955 GN=nek8 PE=2 SV=1
20	P51954	1.44e-35	149	1203	0.074	0.072	NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus OX=10090 GN=Nek1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.27	21.9	ABC1 atypical kinase-like domain
2	PF01636 APH	0.042	25.3	Phosphotransferase enzyme family
3	PF00514 Arm	6.9e+02	11.7	Armadillo/beta-catenin-like repeat
4	PF03477 ATP-cone	6.7e+02	12.3	ATP cone domain
5	PF17372 DUF5394	2.1e+02	12.8	Family of unknown function (DUF5394)
6	PF12330 Haspin_kinase	13	16.2	Haspin like kinase domain
7	PF14531 Kinase-like	0.0042	28.0	Kinase-like
8	PF00069 Pkinase	9e-56	200.7	Protein kinase domain
9	PF17667 Pkinase_fungal	0.0052	27.2	Fungal protein kinase
10	PF07714 PK_Tyr_Ser-Thr	4.2e-36	136.1	Protein tyrosine and serine/threonine kinase
11	PF01163 RIO1	0.29	22.2	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003826199.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003828141.1	0.509	Regulator of chromosome condensation isoform X1
2	9597.XP_008966236.1	0.506	Ankyrin repeat and sterile alpha motif domain containing 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004672	1.000	protein kinase activity
GO:0005488	0.996	binding
GO:0005515	0.990	protein binding
GO:0004674	0.943	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.977	regulation of cellular process
GO:0009987	0.964	cellular process
GO:0065009	0.954	regulation of molecular function
GO:0071900	0.924	regulation of protein serine/threonine kinase activity
GO:0032501	0.890	multicellular organismal process
GO:0010564	0.879	regulation of cell cycle process
GO:0007017	0.855	microtubule-based process
GO:0008152	0.802	metabolic process
GO:0044237	0.784	cellular metabolic process
GO:0001934	0.758	positive regulation of protein phosphorylation
GO:0051347	0.730	positive regulation of transferase activity
GO:0051234	0.707	establishment of localization
GO:0071704	0.705	organic substance metabolic process
GO:0006810	0.697	transport
GO:1901564	0.619	organonitrogen compound metabolic process
GO:0044238	0.558	primary metabolic process
GO:0006793	0.515	phosphorus metabolic process
GO:0006858	0.491	extracellular transport
GO:0043170	0.482	macromolecule metabolic process
GO:0033674	0.479	positive regulation of kinase activity
GO:0045860	0.470	positive regulation of protein kinase activity
GO:0016310	0.463	phosphorylation
GO:0006468	0.453	protein phosphorylation
GO:1902531	0.450	regulation of intracellular signal transduction
GO:0071902	0.424	positive regulation of protein serine/threonine kinase activity
GO:0048523	0.388	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.996	intracellular anatomical structure
GO:0032991	0.988	protein-containing complex
GO:0005737	0.986	cytoplasm
GO:0043226	0.937	organelle
GO:0005829	0.887	cytosol
GO:1902494	0.835	catalytic complex
GO:1990234	0.785	transferase complex
GO:0043229	0.743	intracellular organelle
GO:0043228	0.659	non-membrane-bounded organelle
GO:0043232	0.651	intracellular non-membrane-bounded organelle
GO:0061695	0.530	transferase complex, transferring phosphorus-containing groups
GO:1902911	0.448	protein kinase complex
GO:0043227	0.402	membrane-bounded organelle
GO:0043231	0.394	intracellular membrane-bounded organelle
GO:0005634	0.335	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]