StarFunc result for job id Q6ZWJ1

User Input

>input (553 residues)
MNKNTSTVVSPSLLEKDPAFQMITIAKETGLGLKVLGGINRNEGPLVYIQEIIPGGDCYK
DGRLKPGDQLVSVNKESMIGVSFEEAKSIITGAKLRLESAWEIAFIRQKSDNIQPENLSC
TSLIEASGEYGPQASTLSLFSSPPEILIPKTSSTPKTNNDILSSCEIKTGYNKTVQIPIT
SENSTVGLSNTDVASAWTENYGLQEKISLNPSVRFKAEKLEMALNYLGIQPTKEQHQALR
QQVQADSKGTVSFGDFVQVARNLFCLQLDEVNVGAHEISNILDSQLLPCDSSEADEMERL
KCERDDALKEVNTLKEKLLESDKQRKQLTEELQNVKQEAKAVVEETRALRSRIHLAEAAQ
RQAHGMEMDYEEVIRLLEAKITELKAQLADYSDQNKESVQDLKKRIMVLDCQLRKSEMAR
KTFEASTEKLLHFVEAIQEVFSDNSTPLSNLSERRAVLASQTSLTPLGRNGRSIPATLAL
ESKELVKSVRALLDMDCLPYGWEEAYTADGIKYFINHVTQTTSWIHPVMSVLNLSRSEEN
EEDCSRELPNQKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZWJ1	1.000	1.000	4.116E-87	553	1.000	1.000	Q6ZWJ1.pdb.gz	STXB4_HUMAN Syntaxin-binding protein 4 OS=Homo sapiens OX=9606 GN=STXBP4 PE=1 SV=2
2	AFDB:Q08AL9	0.205	0.212	4.900E-76	531	0.957	0.996	Q08AL9.pdb.gz	Q08AL9_HUMAN STXBP4 protein OS=Homo sapiens OX=9606 GN=STXBP4 PE=1 SV=1
3	AFDB:Q9WV89	0.617	0.613	7.833E-67	557	0.770	0.765	Q9WV89.pdb.gz	STXB4_MOUSE Syntaxin-binding protein 4 OS=Mus musculus OX=10090 GN=Stxbp4 PE=1 SV=1
4	AFDB:P31016	0.160	0.124	3.223E-9	724	0.063	0.048	P31016.pdb.gz	DLG4_RAT Disks large homolog 4 OS=Rattus norvegicus OX=10116 GN=Dlg4 PE=1 SV=1
5	AFDB:D3Z8G7	0.148	0.092	3.328E-8	907	0.067	0.041	D3Z8G7.pdb.gz	D3Z8G7_RAT Tight junction protein 3 OS=Rattus norvegicus OX=10116 GN=Tjp3 PE=1 SV=3
6	AFDB:Q15700	0.150	0.097	4.229E-8	870	0.092	0.059	Q15700.pdb.gz	DLG2_HUMAN Disks large homolog 2 OS=Homo sapiens OX=9606 GN=DLG2 PE=1 SV=3
7	AFDB:G3V9S3	0.154	0.037	4.767E-8	2455	0.087	0.020	G3V9S3.pdb.gz	G3V9S3_RAT Tyrosine-protein phosphatase non-receptor type 13 OS=Rattus norvegicus OX=10116 GN=Ptpn13 PE=1 SV=2
8	AFDB:Q24008	0.146	0.122	5.705E-8	674	0.074	0.061	Q24008.pdb.gz	INAD_DROME Inactivation-no-after-potential D protein OS=Drosophila melanogaster OX=7227 GN=inaD PE=1 SV=2
9	AFDB:Q68DX3	0.168	0.075	7.248E-8	1309	0.063	0.027	Q68DX3.pdb.gz	FRPD2_HUMAN FERM and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FRMPD2 PE=1 SV=3
10	AFDB:Q12923	0.145	0.033	9.777E-8	2485	0.090	0.020	Q12923.pdb.gz	PTN13_HUMAN Tyrosine-protein phosphatase non-receptor type 13 OS=Homo sapiens OX=9606 GN=PTPN13 PE=1 SV=2
11	PDB:7pc3A	0.154	0.208	1.996E-7	405	0.047	0.064	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
12	PDB:7p73A	0.146	0.191	3.633E-7	420	0.038	0.050	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
13	PDB:7pc5A	0.154	0.210	5.203E-7	405	0.047	0.064	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:5n7dA	0.146	0.189	2.062E-6	423	0.040	0.052	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
15	PDB:7qqmA	0.148	0.197	3.328E-6	413	0.034	0.046	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	PDB:2xkxA	0.148	0.114	9.209E-6	721	0.049	0.037	2xkxA.pdb.gz
17	PDB:6t36A	0.155	0.816	2.548E-5	93	0.029	0.172	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
18	PDB:7p70A	0.143	0.192	4.113E-5	407	0.034	0.047	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
19	PDB:2l4tA	0.156	0.553	2.966E-4	124	0.049	0.218	2l4tA.pdb.gz	Promiscuous binding at the crossroads of numerous cancer pathways: insight from the binding of glutaminase interacting protein with glutaminase L.
20	PDB:7pcbA	0.140	0.183	3.549E-4	415	0.033	0.043	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08AL9	0.0	1077	531	0.957	0.996	Q08AL9_HUMAN STXBP4 protein OS=Homo sapiens OX=9606 GN=STXBP4 PE=1 SV=1
2	Q6ZWJ1	0.0	1137	553	1.000	1.000	STXB4_HUMAN Syntaxin-binding protein 4 OS=Homo sapiens OX=9606 GN=STXBP4 PE=1 SV=2
3	Q9WV89	0.0	852	557	0.770	0.765	STXB4_MOUSE Syntaxin-binding protein 4 OS=Mus musculus OX=10090 GN=Stxbp4 PE=1 SV=1
4	Q9QZQ1	1.40e-08	60.5	1820	0.051	0.015	AFAD_MOUSE Afadin OS=Mus musculus OX=10090 GN=Afdn PE=1 SV=3
5	Q8IPP3	1.41e-08	60.5	1817	0.067	0.020	Q8IPP3_DROME Canoe, isoform D OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=2
6	A0A0B4KF82	1.43e-08	60.5	1818	0.067	0.020	A0A0B4KF82_DROME Canoe, isoform I OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
7	J3KN01	1.56e-08	60.1	1816	0.051	0.015	J3KN01_HUMAN Afadin, adherens junction formation factor OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=2
8	P55196	1.56e-08	60.1	1824	0.051	0.015	AFAD_HUMAN Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3
9	A0A0B4KFK9	1.59e-08	60.1	1721	0.067	0.021	A0A0B4KFK9_DROME Canoe, isoform F OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
10	A8MQ02	1.68e-08	60.1	1781	0.051	0.016	A8MQ02_HUMAN Afadin, adherens junction formation factor OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=2
11	Q5TIG5	1.68e-08	60.1	1665	0.051	0.017	Q5TIG5_HUMAN Afadin, adherens junction formation factor OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=1
12	Q8IPP4	1.68e-08	60.1	1882	0.067	0.020	Q8IPP4_DROME Canoe, isoform C OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
13	O35889	1.70e-08	60.1	1829	0.051	0.015	AFAD_RAT Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 SV=1
14	A0A0B4KG43	1.83e-08	60.1	1968	0.067	0.019	A0A0B4KG43_DROME Canoe, isoform H OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
15	A0A0B4KGI6	2.04e-08	59.7	1951	0.067	0.019	A0A0B4KGI6_DROME Canoe, isoform G OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
16	Q9VN82	2.05e-08	59.7	2051	0.067	0.018	Q9VN82_DROME Canoe, isoform E OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=2
17	Q95TT5	2.07e-08	59.7	2051	0.067	0.018	Q95TT5_DROME LD24616p OS=Drosophila melanogaster OX=7227 GN=cno PE=2 SV=1
18	Q24279	2.20e-08	59.7	1893	0.067	0.020	Q24279_DROME Cno OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
19	O55164	1.00e-07	57.8	2054	0.060	0.016	MPDZ_RAT Multiple PDZ domain protein OS=Rattus norvegicus OX=10116 GN=Mpdz PE=1 SV=1
20	A0A2R8Y549	1.42e-07	57.0	1882	0.052	0.015	A0A2R8Y549_HUMAN PATJ crumbs cell polarity complex component OS=Homo sapiens OX=9606 GN=PATJ PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14362 DUF4407	1.6e+02	13.0	Domain of unknown function (DUF4407)
2	PF19353 DUF5930	67	14.0	Family of unknown function (DUF5930)
3	PF20492 ERM_helical	1e+02	14.4	Ezrin/radixin/moesin, alpha-helical domain
4	PF05120 GvpG	57	15.2	Gas vesicle protein G
5	PF14817 HAUS5	3.3e+02	11.4	HAUS augmin-like complex subunit 5
6	PF07544 Med9	6.7e+02	11.8	RNA polymerase II transcription mediator complex subunit 9
7	PF00595 PDZ	6.2e-07	41.0	PDZ domain
8	PF17820 PDZ_6	12	17.3	PDZ domain
9	PF13608 Potyvirid-P3	7.9	17.0	Protein P3 of Potyviral polyprotein
10	PF05061 Pox_A11	43	14.9	Poxvirus A11 Protein
11	PF00397 WW	1.1e-07	43.1	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365530

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317714	0.998	Syntaxin-4
2	9606.ENSP00000314214	0.955	Vesicle-associated membrane protein 2
3	9606.ENSP00000320935	0.944	Solute carrier family 2, facilitated glucose transporter member 4
4	9606.ENSP00000264731	0.941	Tumor protein 63
5	9606.ENSP00000231368	0.901	Leucyl-cystinyl aminopeptidase
6	9606.ENSP00000223369	0.900	Synaptobrevin homolog YKT6
7	9606.ENSP00000299335	0.813	Cytochrome c oxidase assembly protein COX11, mitochondrial
8	9606.ENSP00000460823	0.765	TOM1-like protein 1
9	9606.ENSP00000405111	0.705	Putative ATP-dependent RNA helicase DHX57
10	9606.ENSP00000259711	0.685	Kinesin-like protein KIF13A
11	9606.ENSP00000370671	0.677	Kelch-like protein 42
12	9606.ENSP00000249647	0.643	Synaptosomal-associated protein 23
13	9606.ENSP00000456405	0.610	Target of rapamycin complex subunit LST8
14	9606.ENSP00000345464	0.609	E3 ubiquitin-protein ligase NHLRC1
15	9606.ENSP00000311219	0.602	Tripartite motif-containing protein 59
16	9606.ENSP00000367197	0.582	Secretagogin, EF-hand calcium binding protein
17	9606.ENSP00000375892	0.527	RAC-beta serine/threonine-protein kinase
18	9606.ENSP00000295736	0.511	Sodium bicarbonate cotransporter 3
19	9606.ENSP00000011619	0.506	Ran-binding protein 9
20	9606.ENSP00000359025	0.505	Syntaxin-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019905	0.976	syntaxin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0050896	0.984	response to stimulus
GO:0048518	0.959	positive regulation of biological process
GO:0048522	0.890	positive regulation of cellular process
GO:0051716	0.887	cellular response to stimulus
GO:0065008	0.853	regulation of biological quality
GO:0032879	0.820	regulation of localization
GO:0006950	0.680	response to stress
GO:0023051	0.616	regulation of signaling
GO:0010646	0.616	regulation of cell communication
GO:0042127	0.557	regulation of cell population proliferation
GO:0071840	0.415	cellular component organization or biogenesis
GO:0051049	0.415	regulation of transport
GO:0051179	0.410	localization
GO:0051726	0.402	regulation of cell cycle
GO:0016043	0.352	cellular component organization
GO:0010564	0.337	regulation of cell cycle process
GO:0051234	0.324	establishment of localization
GO:0007154	0.320	cell communication
GO:0032880	0.308	regulation of protein localization
GO:0006810	0.304	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031982	0.996	vesicle
GO:0005622	0.994	intracellular anatomical structure
GO:0005576	0.986	extracellular region
GO:0043229	0.982	intracellular organelle
GO:0005737	0.973	cytoplasm
GO:0043231	0.968	intracellular membrane-bounded organelle
GO:0043230	0.953	extracellular organelle
GO:0005829	0.938	cytosol
GO:0005615	0.886	extracellular space
GO:0065010	0.880	extracellular membrane-bounded organelle
GO:1903561	0.849	extracellular vesicle
GO:0016020	0.807	membrane
GO:0070062	0.804	extracellular exosome
GO:0043232	0.653	intracellular non-membrane-bounded organelle
GO:0031410	0.389	cytoplasmic vesicle
GO:0071944	0.349	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]