StarFunc result for job id Q6ZWJ8

User Input

>input (1568 residues)
MAGVGAAALSLLLHLGALALAAGAEGGAVPREPPGQQTTAHSSVLAGNSQEQWHPLREWL
GRLEAAVMELREQNKDLQTRVRQLESCECHPASPQCWGLGRAWPEGARWEPDACTACVCQ
DGAAHCGPQAHLPHCRGCSQNGQTYGNGETFSPDACTTCRCLTGAVQCQGPSCSELNCLE
SCTPPGECCPICRPGCDYEGQLYEEGVTFLSSSNPCLQCTCLRSRVRCMALKCPPSPCPE
PVLRPGHCCPTCQGCTEGGSHWEHGQEWTTPGDPCRICRCLEGHIQCRQRECASLCPYPA
RPLPGTCCPVCDGCFLNGREHRSGEPVGSGDPCSHCRCANGSVQCEPLPCPPVPCRHPGK
IPGQCCPVCDGCEYQGHQYQSQETFRLQERGLCVRCSCQAGEVSCEEQECPVTPCALPAS
GRQLCPACELDGEEFAEGVQWEPDGRPCTACVCQDGVPKCGAVLCPPAPCQHPTQPPGAC
CPSCDSCTYHSQVYANGQNFTDADSPCHACHCQDGTVTCSLVDCPPTTCARPQSGPGQCC
PRCPDCILEEEVFVDGESFSHPRDPCQECRCQEGHAHCQPRPCPRAPCAHPLPGTCCPND
CSGCAFGGKEYPSGADFPHPSDPCRLCRCLSGNVQCLARRCVPLPCPEPVLLPGECCPQC
PAAPAPAGCPRPGAAHARHQEYFSPPGDPCRRCLCLDGSVSCQRLPCPPAPCAHPRQGPC
CPSCDGCLYQGKEFASGERFPSPTAACHLCLCWEGSVSCEPKACAPALCPFPARGDCCPD
CDGCEYLGESYLSNQEFPDPREPCNLCTCLGGFVTCGRRPCEPPGCSHPLIPSGHCCPTC
QGCRYHGVTTASGETLPDPLDPTCSLCTCQEGSMRCQKKPCPPALCPHPSPGPCFCPVCH
SCLSQGREHQDGEEFEGPAGSCEWCRCQAGQVSCVRLQCPPLPCKLQVTERGSCCPRCRG
CLAHGEEHPEGSRWVPPDSACSSCVCHEGVVTCARIQCISSCAQPRQGPHDCCPQCSDCE
HEGRKYEPGESFQPGADPCEVCICEPQPEGPPSLRCHRRQCPSLVGCPPSQLLPPGPQHC
CPTCAEALSNCSEGLLGSELAPPDPCYTCQCQDLTWLCIHQACPELSCPLSERHTPPGSC
CPVCRAPTQSCVHQGREVASGERWTVDTCTSCSCMAGTVRCQSQRCSPLSCGPDKAPALS
PGSCCPRCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCHSGDFSVHVTNDDRG
RSGVAWTQEVAVLLGDMAVRLLQDGAVTVDGHPVALPFLQEPLLYVELRGHTVILHAQPG
LQVLWDGQSQVEVSVPGSYQGRTCGLCGNFNGFAQDDLQGPEGLLLPSEAAFGNSWQVSE
GLWPGRPCSAGREVDPCRAAGYRARREANARCGVLKSSPFSRCHAVVPPEPFFAACVYDL
CACGPGSSADACLCDALEAYASHCRQAGVTPTWRGPTLCVVGCPLERGFVFDECGPPCPR
TCFNQHIPLGELAAHCVRPCVPGCQCPAGLVEHEAHCIPPEACPQVLLTGDQPLGARPSP
SREPQETP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3U492	0.227	0.230	0.000	1550	0.804	0.814	Q3U492.pdb.gz	KCP_MOUSE Kielin/chordin-like protein OS=Mus musculus OX=10090 GN=Kcp PE=1 SV=2
2	AFDB:F1QK57	0.200	0.145	1.889E-31	2201	0.088	0.063	F1QK57.pdb.gz
3	AFDB:Q96DN2	0.075	0.104	1.179E-29	955	0.152	0.250	Q96DN2.pdb.gz	VWCE_HUMAN von Willebrand factor C and EGF domain-containing protein OS=Homo sapiens OX=9606 GN=VWCE PE=1 SV=2
4	AFDB:Q80Z19	0.194	0.117	3.986E-28	2680	0.156	0.091	Q80Z19.pdb.gz	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
5	AFDB:Q6W4X9	0.193	0.126	1.012E-21	2439	0.078	0.050	Q6W4X9.pdb.gz	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
6	PDB:1haqA	0.051	0.060	1.162E-12	1213	0.119	0.153	1haqA.pdb.gz
7	AFDB:Q63661	0.139	0.097	2.162E-12	2344	0.151	0.101	Q63661.pdb.gz	MUC4_RAT Mucin-4 OS=Rattus norvegicus OX=10116 GN=Muc4 PE=1 SV=2
8	AFDB:Q6RG02	0.137	0.085	1.226E-11	2586	0.038	0.023	Q6RG02.pdb.gz	VIT_PENME Vitellogenin OS=Penaeus merguiensis OX=71412 PE=1 SV=2
9	AFDB:P37889	0.058	0.072	1.429E-11	1221	0.129	0.166	P37889.pdb.gz	FBLN2_MOUSE Fibulin-2 OS=Mus musculus OX=10090 GN=Fbln2 PE=1 SV=2
10	AFDB:F1NWN4	0.057	0.072	1.045E-10	1196	0.129	0.169	F1NWN4.pdb.gz
11	PDB:2gsxA	0.049	0.066	3.527E-10	951	0.090	0.148	2gsxA.pdb.gz
12	AFDB:Q99102	0.124	0.094	7.647E-10	2169	0.154	0.111	Q99102.pdb.gz	MUC4_HUMAN Mucin-4 OS=Homo sapiens OX=9606 GN=MUC4 PE=1 SV=5
13	PDB:7mq8LR	0.044	0.074	3.528E-2	773	0.047	0.094	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7rroe	0.042	0.082	4.792E-2	610	0.037	0.095	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:5dg2B	0.037	0.238	7.208E-2	131	0.010	0.115	5dg2B.pdb.gz	Human galectin-2 interacts with carbohydrates and peptides non-classically: new insight from X-ray crystallography and hemagglutination.
16	PDB:6rlbD	0.037	0.098	1.264E-1	446	0.011	0.038	6rlbD.pdb.gz
17	PDB:4ga9A	0.035	0.194	1.716E-1	134	0.006	0.067	4ga9A.pdb.gz	Gal-1 structure analysis
18	PDB:7uknA	0.056	0.073	1.901E-1	1059	0.062	0.092	7uknA.pdb.gz	Insight into Viral Hijacking of CRL4 Ubiquitin Ligase through Structural Analysis of the pUL145-DDB1 Complex.
19	PDB:1iwmA	0.030	0.196	2.215E-1	177	0.011	0.102	1iwmA.pdb.gz
20	PDB:3zwlD	0.036	0.122	2.717E-1	352	0.009	0.040	3zwlD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3U492	0.0	2395	1550	0.795	0.805	KCP_MOUSE Kielin/chordin-like protein OS=Mus musculus OX=10090 GN=Kcp PE=1 SV=2
2	A6H8K2	1.54e-103	348	668	0.146	0.343	A6H8K2_DANRE BMP-binding endothelial regulator protein precursor OS=Danio rerio OX=7955 GN=cvl2 PE=2 SV=1
3	Q8CJ69	1.00e-99	338	685	0.143	0.328	BMPER_MOUSE BMP-binding endothelial regulator protein OS=Mus musculus OX=10090 GN=Bmper PE=1 SV=1
4	Q8N8U9	1.38e-98	335	685	0.144	0.330	BMPER_HUMAN BMP-binding endothelial regulator protein OS=Homo sapiens OX=9606 GN=BMPER PE=1 SV=3
5	Q5D734	2.45e-93	319	668	0.140	0.329	Q5D734_DANRE Crossveinless 2 OS=Danio rerio OX=7955 GN=cvl2 PE=1 SV=1
6	Q9GYX3	5.65e-86	300	751	0.136	0.285	Q9GYX3_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
7	Q9W2H2	7.21e-85	297	751	0.135	0.281	Q9W2H2_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
8	Q8CIZ8	5.17e-53	208	2813	0.098	0.054	VWF_MOUSE von Willebrand factor OS=Mus musculus OX=10090 GN=Vwf PE=1 SV=2
9	A2VEC9	4.52e-52	205	5150	0.112	0.034	SSPO_HUMAN SCO-spondin OS=Homo sapiens OX=9606 GN=SSPOP PE=2 SV=2
10	Q28983	1.57e-50	200	2476	0.080	0.051	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
11	O88799	5.23e-50	199	5376	0.077	0.022	ZAN_MOUSE Zonadhesin OS=Mus musculus OX=10090 GN=Zan PE=1 SV=1
12	E7F9Z1	3.82e-48	192	2812	0.085	0.048	E7F9Z1_DANRE von Willebrand factor OS=Danio rerio OX=7955 GN=VWF PE=1 SV=3
13	O08523	9.24e-45	181	2155	0.090	0.065	TECTA_MOUSE Alpha-tectorin OS=Mus musculus OX=10090 GN=Tecta PE=1 SV=2
14	Q8CG65	2.12e-44	180	4998	0.081	0.025	SSPO_MOUSE SCO-spondin OS=Mus musculus OX=10090 GN=Sspo PE=2 SV=2
15	P04275	3.36e-44	179	2813	0.092	0.051	VWF_HUMAN von Willebrand factor OS=Homo sapiens OX=9606 GN=VWF PE=1 SV=4
16	O75443	5.33e-44	178	2155	0.089	0.065	TECTA_HUMAN Alpha-tectorin OS=Homo sapiens OX=9606 GN=TECTA PE=1 SV=3
17	Q96DN2	1.35e-43	175	955	0.089	0.146	VWCE_HUMAN von Willebrand factor C and EGF domain-containing protein OS=Homo sapiens OX=9606 GN=VWCE PE=1 SV=2
18	E9Q9C6	1.60e-43	177	2583	0.080	0.049	E9Q9C6_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
19	E9Q0B5	1.62e-43	177	2583	0.080	0.049	E9Q0B5_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
20	Q9Y6R7	2.99e-43	176	5405	0.078	0.023	FCGBP_HUMAN IgGFc-binding protein OS=Homo sapiens OX=9606 GN=FCGBP PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12714 TILa	4.3e-24	95.5	TILa domain
2	PF00093 VWC	1.4e-121	408.2	von Willebrand factor type C domain
3	PF00094 VWD	1.5e-33	127.8	von Willebrand factor type D domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000016668

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000001723	0.814	FRAS1 related extracellular matrix protein 2
2	9555.ENSPANP00000016924	0.755	Bone morphogenetic protein 4, isoform 3 (Predicted)
3	9555.ENSPANP00000007015	0.690	Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.
4	9555.ENSPANP00000001424	0.689	Actin, beta-like 2
5	9555.ENSPANP00000014553	0.662	Bone morphogenetic protein 7
6	9555.ENSPANP00000015709	0.637	RNA binding motif protein 20
7	9555.ENSPANP00000006071	0.636	Transmembrane protein 205
8	9555.ENSPANP00000009256	0.636	Cysteine-rich with EGF-like domains 1
9	9555.ENSPANP00000011946	0.610	Neurofilament, light polypeptide
10	9555.ENSPANP00000008976	0.608	Leucine rich repeat containing 8 family, member D
11	9555.ENSPANP00000001255	0.537	SHC (Src homology 2 domain containing) transforming protein 2
12	9555.ENSPANP00000010048	0.535	Leucine rich repeat containing 8 family, member C
13	9555.ENSPANP00000014115	0.535	Probable chloride channel
14	9555.ENSPANP00000002219	0.534	FRAS1 related extracellular matrix 3
15	9555.ENSPANP00000016663	0.504	Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0032502	0.974	developmental process
GO:0048856	0.962	anatomical structure development
GO:0048518	0.960	positive regulation of biological process
GO:0090092	0.956	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048522	0.949	positive regulation of cellular process
GO:0090287	0.934	regulation of cellular response to growth factor stimulus
GO:0090100	0.934	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0030510	0.897	regulation of BMP signaling pathway
GO:0030154	0.844	cell differentiation
GO:0048468	0.663	cell development
GO:0030097	0.612	hemopoiesis
GO:0002244	0.495	hematopoietic progenitor cell differentiation
GO:0007275	0.377	multicellular organism development
GO:0050896	0.361	response to stimulus
GO:0048519	0.350	negative regulation of biological process
GO:0048523	0.335	negative regulation of cellular process
GO:0050793	0.326	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0005622	0.723	intracellular anatomical structure
GO:0071944	0.566	cell periphery
GO:0043226	0.528	organelle
GO:0016020	0.396	membrane
GO:0005737	0.384	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]