StarFunc result for job id Q6ZWK4

User Input

>input (172 residues)
MLTEVMEVWHGLVIAVVSLFLQACFLTAINYLLSRHMAHKSEQILKAASLQVPRPSPGHH
HPPAVKEMKETQTERDIPMSDSLYRHDSDTPSDSLDSSCSSPPACQATEDVDYTQVVFSD
PGELKNDSPLDYENIKEITDYVNVNPERHKPSFWYFVNPALSEPAEYDQVAM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZWK4	0.999	0.999	1.017E-25	172	1.000	1.000	Q6ZWK4.pdb.gz	RHEX_HUMAN Regulator of hemoglobinization and erythroid cell expansion protein OS=Homo sapiens OX=9606 GN=RHEX PE=1 SV=1
2	AFDB:P34555	0.121	0.099	3.238E-1	205	0.174	0.146	P34555.pdb.gz	HLH4_CAEEL Helix-loop-helix protein 4 OS=Caenorhabditis elegans OX=6239 GN=hlh-4 PE=2 SV=1
3	AFDB:Q9D2J4	0.207	0.099	5.763E-1	407	0.169	0.071	Q9D2J4.pdb.gz	VSIG1_MOUSE V-set and immunoglobulin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Vsig1 PE=1 SV=1
4	AFDB:F8W1H0	0.177	0.181	9.543E-1	166	0.134	0.139	F8W1H0.pdb.gz	F8W1H0_HUMAN Chromosome 17 open reading frame 49 OS=Homo sapiens OX=9606 GN=C17orf49 PE=1 SV=1
5	AFDB:P97484	0.237	0.060	1.102	841	0.169	0.034	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
6	AFDB:Q6IUP1	0.125	0.065	1.102	357	0.145	0.070	Q6IUP1.pdb.gz	SOLH1_MOUSE Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 1 OS=Mus musculus OX=10090 GN=Sohlh1 PE=1 SV=1
7	AFDB:Q9D9V2	0.192	0.129	1.185	337	0.174	0.089	Q9D9V2.pdb.gz	EQTN_MOUSE Equatorin OS=Mus musculus OX=10090 GN=Eqtn PE=1 SV=2
8	AFDB:A0A024R2J4	0.295	0.189	1.368	292	0.128	0.075	A0A024R2J4.pdb.gz
9	AFDB:Q9SIB4	0.222	0.159	1.698	244	0.128	0.090	Q9SIB4.pdb.gz	WOX3_ARATH WUSCHEL-related homeobox 3 OS=Arabidopsis thaliana OX=3702 GN=WOX3 PE=1 SV=1
10	AFDB:Q86XK7	0.274	0.128	1.825	387	0.169	0.075	Q86XK7.pdb.gz	VSIG1_HUMAN V-set and immunoglobulin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=VSIG1 PE=1 SV=1
11	PDB:6tedR	0.128	0.096	7.695	244	0.064	0.045	6tedR.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZWK4	4.90e-128	358	172	1.000	1.000	RHEX_HUMAN Regulator of hemoglobinization and erythroid cell expansion protein OS=Homo sapiens OX=9606 GN=RHEX PE=1 SV=1
2	Q9D5S7	0.15	34.7	820	0.134	0.028	LRGUK_MOUSE Leucine-rich repeat and guanylate kinase domain-containing protein OS=Mus musculus OX=10090 GN=Lrguk PE=1 SV=1
3	Q8I8U7	1.2	32.0	3790	0.105	0.005	TRA1_DROME Transcription-associated protein 1 OS=Drosophila melanogaster OX=7227 GN=Nipped-A PE=1 SV=4
4	P02549	2.6	30.8	2419	0.105	0.007	SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTA1 PE=1 SV=5
5	P83758	2.8	30.8	448	0.122	0.047	DMT3A_DANRE Doublesex- and mab-3-related transcription factor 3a OS=Danio rerio OX=7955 GN=dmrt3a PE=1 SV=2
6	Q99PJ6	3.5	30.4	736	0.145	0.034	Q99PJ6_RAT RCG38839 OS=Rattus norvegicus OX=10116 GN=Zfp709 PE=2 SV=1
7	Q9LFX9	4.2	30.0	576	0.099	0.030	PTR13_ARATH Protein NRT1/ PTR FAMILY 2.12 OS=Arabidopsis thaliana OX=3702 GN=NPF2.12 PE=1 SV=2
8	O75385	9.2	29.3	1050	0.110	0.018	ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens OX=9606 GN=ULK1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15763 DUF4692	2.2e-80	280.5	Regulator of human erythroid cell expansion (RHEX)
2	PF20487 DUF6726	6.3e+02	11.7	Family of unknown function (DUF6726)
3	PF05083 LST1	3e+02	13.1	LST-1 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356093

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376345	0.702	Growth factor receptor-bound protein 2
2	9606.ENSP00000349358	0.564	Uncharacterized protein C12orf29
3	9606.ENSP00000294811	0.562	UPF0739 protein C1orf74
4	9606.ENSP00000350102	0.518	Torsin-4A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005128	1.000	erythropoietin receptor binding
GO:0042802	0.382	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0010033	0.963	response to organic substance
GO:0071310	0.952	cellular response to organic substance
GO:0007166	0.921	cell surface receptor signaling pathway
GO:0048522	0.865	positive regulation of cellular process
GO:0034097	0.848	response to cytokine
GO:0045637	0.807	regulation of myeloid cell differentiation
GO:0045646	0.801	regulation of erythrocyte differentiation
GO:0019221	0.770	cytokine-mediated signaling pathway
GO:0051094	0.604	positive regulation of developmental process
GO:0045639	0.593	positive regulation of myeloid cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.955	organelle
GO:0043227	0.950	membrane-bounded organelle
GO:0043229	0.935	intracellular organelle
GO:0005576	0.913	extracellular region
GO:0012505	0.872	endomembrane system
GO:0031982	0.865	vesicle
GO:0043231	0.848	intracellular membrane-bounded organelle
GO:0043233	0.565	organelle lumen
GO:0070013	0.564	intracellular organelle lumen
GO:0005634	0.510	nucleus
GO:0005829	0.490	cytosol
GO:0043230	0.366	extracellular organelle
GO:0070062	0.359	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]