StarFunc result for job id Q702N8

User Input

>input (1843 residues)
MADTQTQVAPTPTMRMATAEDLPLPPPPALEDLPLPPPKESFSKFHQQRQASELRRLYRH
IHPELRKNLAEAVAEDLAEVLGSEEPTEGDVQCMRWIFENWRLDAIGEHERPAAKEPVLC
GDVQATSRKFEEGSFANSTDQEPTRPQPGGGDVRAARWLFETKPLDELTGQAKELEATVR
EPAASGDVQGTRMLFETRPLDRLGSRPSLQEQSPLELRSEIQELKGDVKKTVKLFQTEPL
CAIQDAEGAIHEVKAACREEIQSNAVRSARWLFETRPLDAINQDPSQVRVIRGISLEEGA
RPDVSATRWIFETQPLDAIREILVDEKDFQPSPDLIPPGPDVQQQQHLFETRALDTLKGD
EEAGAEAPPKEEVVPGDVRSTLWLFETKPLDAFRDKVQVGHLQRVDPQDGEGHLSSDSSS
ALPFSQSAPQRDELKGDVKTFKNLFETLPLDSIGQGEVLAHGSPSREEGTDSAGQAQGIG
SPVYAMQDSKGRLHALTSVSREQIVGGDVQGYRWMFETQPLDQLGRSPSTIDVVRGITRQ
EVVAGDVGTARWLFETQPLEMIHQREQQERQKEEGKSQGDPQPEAPPKGDVQTIRWLFET
CPMSELAEKQGSEVTDPTAKAEAQSCTWMFKPQPVDRPVGSREQHLQVSQVPAGERQTDR
HVFETEPLQASGRPCGRRPVRYCSRVEIPSGQVSRQKEVFQALEAGKKEEQEPRVIAGSI
PAGSVHKFTWLFENCPMGSLAAESIQGGNLLEEQPMSPSGNRMQESQETAAEGTLRTLHA
TPGILHHGGILMEARGPGELCLAKYVLSGTGQGHPYIRKEELVSGELPRIICQVLRRPDV
DQQGLLVQEDPTGQLQLKPLRLPTPGSSGNIEDMDPELQQLLACGLGTSVARTGLVMQET
EQGLVALTAYSLQPRLTSKASERSSVQLLASCIDKGDLSGLHSLRWEPPADPSPVPASEG
AQSLHPTESIIHVPPLDPSMGMGHLRASGATPCPPQAIGKAVPLAGEAAAPAQLQNTEKQ
EDSHSGQKGMAVLGKSEGATTTPPGPGAPDLLAAMQSLRMATAEAQSLHQQVLNKHKQGP
TPTATSNPIQDGLRKAGATQSNIRPGGGSDPRIPAAPRKVSREEQALPRGLPGGWVTIQD
GIYTAHPVRTFDPPGGVQLSQREPQSRHRETALSVQAPRPLQGGPGQSTGPGREEPGGCT
QMAWGPPGKAMAEVCPGGLQAAETTLKTAPLGRHILASGPQAAGASPHPHNAFVPPPPTL
PAAVTGPDFPAGAHRAEDSIQQASEPLKDPLLHSHSSPAGQRTPGGSQTKTPKLDPTMPP
KKKPQLPPKPAHLTQSHPPQRLPKPLPLSPSFSSEVGQREHQRGERDTAIPQPAKVPTTV
DQGHIPLARCPSGHSQPSLQHGLSTTAPRPTKNQATGSNAQSSEPPKLNALNHDPTSPQW
GPGPSGEQPMEGSHQGAPESPDSLQRNQKELQGLLNQVQALEKEAASSVDVQALRRLFEA
VPQLGGAAPQAPAAHQKPEASVEQAFGELTRVSTEVAQLKEQTLARLLDIEEAVHKALSS
MSSLQPEASARGHFQGPPKDHSAHKISVTVSSSARPSGSGQEVGGQTAVKNQAKVECHTE
AQSQVKIRNHTEARGHTASTAPSTRRQETSREYLCPPRVLPSSRDSPSSPTFISIQSATR
KPLETPSFKGNPDVSVKSTQLAQDIGQALLHQKGVQDKTGKKDITQCSVQPEPAPPSASP
LPRGWQKSVLELQTGPGSSQHYGAMRTVTEQYEEVDQFGNTVLMSSTTVTEQAEPPRNPG
SHLGLHASPLLRQFLHSPAGFSSDLTEAETVQVSCSYSQPAAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70373	0.174	0.249	0.000	1129	0.477	0.779	O70373.pdb.gz	XIRP1_MOUSE Xin actin-binding repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Xirp1 PE=1 SV=2
2	AFDB:Q702N8	1.000	1.000	0.000	1843	1.000	1.000	Q702N8.pdb.gz	XIRP1_HUMAN Xin actin-binding repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=XIRP1 PE=1 SV=1
3	AFDB:Q5T200	0.038	0.041	3.396E-8	1668	0.122	0.135	Q5T200.pdb.gz	ZC3HD_HUMAN Zinc finger CCCH domain-containing protein 13 OS=Homo sapiens OX=9606 GN=ZC3H13 PE=1 SV=1
4	AFDB:Q8IY92	0.036	0.036	2.402E-7	1834	0.136	0.137	Q8IY92.pdb.gz	SLX4_HUMAN Structure-specific endonuclease subunit SLX4 OS=Homo sapiens OX=9606 GN=SLX4 PE=1 SV=3
5	AFDB:Q86UR5	0.044	0.047	7.591E-7	1692	0.122	0.133	Q86UR5.pdb.gz	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
6	AFDB:G3V9G5	0.039	0.043	1.012E-6	1557	0.130	0.154	G3V9G5.pdb.gz	G3V9G5_RAT Synemin OS=Rattus norvegicus OX=10116 GN=Synm PE=1 SV=2
7	AFDB:A0A1D5NS76	0.050	0.047	1.604E-6	2005	0.142	0.131	A0A1D5NS76.pdb.gz
8	AFDB:E9Q784	0.039	0.041	2.019E-6	1729	0.125	0.134	E9Q784.pdb.gz	ZC3HD_MOUSE Zinc finger CCCH domain-containing protein 13 OS=Mus musculus OX=10090 GN=Zc3h13 PE=1 SV=1
9	AFDB:Q17353	0.035	0.043	2.019E-6	1379	0.113	0.152	Q17353.pdb.gz	PAR3_CAEEL Partitioning defective protein 3 OS=Caenorhabditis elegans OX=6239 GN=par-3 PE=1 SV=1
10	AFDB:Q9VU86	0.035	0.035	2.019E-6	1873	0.133	0.131	Q9VU86.pdb.gz	Q9VU86_DROME LD34837p OS=Drosophila melanogaster OX=7227 GN=Spt20 PE=1 SV=3
11	PDB:7st9G	0.031	0.098	3.664E-2	340	0.012	0.068	7st9G.pdb.gz	Mechanisms of loading and release of the 9-1-1 checkpoint clamp.
12	PDB:2zbkB	0.025	0.076	4.886E-2	506	0.011	0.040	2zbkB.pdb.gz	Crystal Structure of an Intact Type II DNA Topoisomerase: Insights into DNA Transfer Mechanisms
13	PDB:7wluA	0.024	0.029	1.093E-1	1498	0.011	0.014	7wluA.pdb.gz	Structure deformation and curvature sensing of PIEZO1 in lipid membranes.
14	PDB:2l9cA	0.031	0.192	1.376E-1	176	0.008	0.080	2l9cA.pdb.gz
15	PDB:8d0kF	0.032	0.052	1.458E-1	915	0.009	0.017	8d0kF.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
16	PDB:7z6hA	0.028	0.105	1.835E-1	247	0.009	0.069	7z6hA.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
17	PDB:6fhmA	0.023	0.107	2.310E-1	193	0.011	0.109	6fhmA.pdb.gz
18	PDB:3t1eA	0.025	0.059	2.447E-1	447	0.008	0.031	3t1eA.pdb.gz
19	PDB:4g1eB	0.018	0.037	3.080E-1	709	0.003	0.008	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
20	PDB:6uzbA	0.032	0.088	4.107E-1	562	0.006	0.020	6uzbA.pdb.gz	Atomic structures of anthrax toxin protective antigen channels bound to partially unfolded lethal and edema factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70373	0.0	1683	1129	0.476	0.778	XIRP1_MOUSE Xin actin-binding repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Xirp1 PE=1 SV=2
2	Q702N8	0.0	3713	1843	1.000	1.000	XIRP1_HUMAN Xin actin-binding repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=XIRP1 PE=1 SV=1
3	A4UGR9	1.97e-123	436	3374	0.151	0.082	XIRP2_HUMAN Xin actin-binding repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=XIRP2 PE=1 SV=2
4	Q4U4S6	1.08e-119	424	3784	0.151	0.073	XIRP2_MOUSE Xin actin-binding repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Xirp2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08043 Xin	6.6e-82	277.6	Xin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343140

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000285083	0.866	Oxidoreductase NAD-binding domain-containing protein 1
2	9606.ENSP00000327145	0.832	Filamin-C
3	9606.ENSP00000253693	0.821	Calpain-7
4	9606.ENSP00000341940	0.765	Caveolin-3
5	9606.ENSP00000420040	0.723	Kv channel-interacting protein 2
6	9606.ENSP00000262113	0.686	Myomesin-2
7	9606.ENSP00000306997	0.679	Myozenin-2
8	9606.ENSP00000344456	0.672	Catenin beta-1
9	9606.ENSP00000261448	0.650	Calsequestrin-2
10	9606.ENSP00000443495	0.615	Alpha-actinin-2
11	9606.ENSP00000337501	0.611	Nuclear receptor-interacting protein 2
12	9606.ENSP00000358365	0.605	Nebulin-related-anchoring protein
13	9606.ENSP00000308727	0.594	Sushi domain containing 5
14	9606.ENSP00000317790	0.578	Spectrin beta, non-erythrocytic 5
15	9606.ENSP00000431813	0.572	Cysteine and glycine-rich protein 3
16	9606.ENSP00000368808	0.553	Small muscular protein
17	9606.ENSP00000438788	0.551	Cullin-7
18	9606.ENSP00000355809	0.539	Protein enabled homolog
19	9606.ENSP00000439281	0.532	Triadin
20	9606.ENSP00000244669	0.514	C->U-editing enzyme APOBEC-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0051015	1.000	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.994	biological regulation
GO:0065009	0.969	regulation of molecular function
GO:0030029	0.954	actin filament-based process
GO:0007010	0.953	cytoskeleton organization
GO:0097435	0.945	supramolecular fiber organization
GO:0030036	0.916	actin cytoskeleton organization
GO:0050789	0.798	regulation of biological process
GO:0044092	0.718	negative regulation of molecular function
GO:0051098	0.619	regulation of binding
GO:0050794	0.606	regulation of cellular process
GO:0051100	0.500	negative regulation of binding
GO:0032502	0.441	developmental process
GO:0032501	0.441	multicellular organismal process
GO:0048856	0.433	anatomical structure development
GO:0050896	0.339	response to stimulus
GO:0007015	0.321	actin filament organization
GO:0043393	0.305	regulation of protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	0.996	cytoskeleton
GO:0030055	0.995	cell-substrate junction
GO:0015629	0.994	actin cytoskeleton
GO:0005925	0.942	focal adhesion
GO:0005829	0.912	cytosol
GO:0032432	0.884	actin filament bundle
GO:0042641	0.866	actomyosin
GO:0097517	0.866	contractile actin filament bundle
GO:0001725	0.860	stress fiber
GO:0043231	0.759	intracellular membrane-bounded organelle
GO:0016020	0.330	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]